Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150V7M2

Protein Details
Accession A0A150V7M2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-82RETRDRLMEKRKRRAERESRDGGBasic
NLS Segment(s)
PositionSequence
69-74KRKRRA
Subcellular Location(s) mito 18, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVNKILFWSGFGLAVRFWQLGIEMRPFLTQPWAYPIYGAIGASFGYYLQGVDDSQMRYLRETRDRLMEKRKRRAERESRDGGVIAGNLGSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.11
4 0.1
5 0.09
6 0.1
7 0.12
8 0.15
9 0.16
10 0.14
11 0.15
12 0.16
13 0.16
14 0.15
15 0.17
16 0.15
17 0.13
18 0.18
19 0.19
20 0.18
21 0.18
22 0.18
23 0.14
24 0.14
25 0.13
26 0.07
27 0.06
28 0.06
29 0.06
30 0.05
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.04
39 0.07
40 0.07
41 0.09
42 0.11
43 0.12
44 0.13
45 0.16
46 0.21
47 0.26
48 0.29
49 0.3
50 0.37
51 0.41
52 0.46
53 0.54
54 0.58
55 0.61
56 0.68
57 0.76
58 0.76
59 0.78
60 0.83
61 0.83
62 0.84
63 0.83
64 0.8
65 0.72
66 0.64
67 0.58
68 0.47
69 0.37
70 0.27
71 0.19