Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150V3G8

Protein Details
Accession A0A150V3G8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-35QTEPPRKTRFDQRSRSPKPRDSDHydrophilic
NLS Segment(s)
PositionSequence
25-32RSRSPKPR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031121  RIK/BLOM7  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
Amino Acid Sequences MADEPRKRSRFDQTEPPRKTRFDQRSRSPKPRDSDEGSRRERSPMRSHEDPIKSAQAKAAEVAARVNAMHAKKGIQHVDVPPIRKPSSPNGSSGASKSPAPPASLNSDIYTQDGDFIKDIEVNDLRNRYTLTKGSTQKLIKEKTGADVTTRGSFYPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.78
4 0.72
5 0.67
6 0.66
7 0.66
8 0.65
9 0.65
10 0.69
11 0.73
12 0.79
13 0.85
14 0.89
15 0.87
16 0.83
17 0.79
18 0.77
19 0.74
20 0.7
21 0.71
22 0.7
23 0.7
24 0.68
25 0.67
26 0.6
27 0.59
28 0.56
29 0.52
30 0.52
31 0.51
32 0.53
33 0.52
34 0.54
35 0.56
36 0.54
37 0.5
38 0.44
39 0.44
40 0.37
41 0.33
42 0.33
43 0.25
44 0.23
45 0.21
46 0.2
47 0.13
48 0.13
49 0.13
50 0.1
51 0.08
52 0.08
53 0.08
54 0.1
55 0.09
56 0.1
57 0.1
58 0.11
59 0.13
60 0.18
61 0.19
62 0.16
63 0.18
64 0.18
65 0.26
66 0.27
67 0.27
68 0.25
69 0.28
70 0.28
71 0.26
72 0.28
73 0.28
74 0.35
75 0.34
76 0.33
77 0.32
78 0.33
79 0.32
80 0.31
81 0.26
82 0.19
83 0.18
84 0.17
85 0.19
86 0.19
87 0.2
88 0.19
89 0.19
90 0.24
91 0.26
92 0.26
93 0.22
94 0.22
95 0.2
96 0.2
97 0.19
98 0.12
99 0.13
100 0.13
101 0.12
102 0.11
103 0.11
104 0.11
105 0.12
106 0.12
107 0.14
108 0.14
109 0.16
110 0.2
111 0.22
112 0.22
113 0.21
114 0.23
115 0.21
116 0.24
117 0.26
118 0.27
119 0.34
120 0.39
121 0.42
122 0.48
123 0.48
124 0.51
125 0.55
126 0.55
127 0.5
128 0.49
129 0.46
130 0.45
131 0.47
132 0.41
133 0.35
134 0.34
135 0.34
136 0.34
137 0.33