Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UNL9

Protein Details
Accession A0A150UNL9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-54HNPQSTEKKKPGKRQSRHYCKNTDQRRKPPGRPNADSHydrophilic
NLS Segment(s)
PositionSequence
25-32KKKPGKRQ
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGEYNSALPNSATGGIDHNPQSTEKKKPGKRQSRHYCKNTDQRRKPPGRPNADSLQDQQTQNTELEEDETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.17
4 0.17
5 0.16
6 0.16
7 0.17
8 0.23
9 0.24
10 0.3
11 0.35
12 0.44
13 0.51
14 0.61
15 0.7
16 0.75
17 0.78
18 0.83
19 0.85
20 0.86
21 0.89
22 0.84
23 0.8
24 0.77
25 0.79
26 0.79
27 0.78
28 0.76
29 0.76
30 0.82
31 0.82
32 0.83
33 0.83
34 0.82
35 0.8
36 0.76
37 0.72
38 0.68
39 0.64
40 0.58
41 0.52
42 0.48
43 0.44
44 0.4
45 0.35
46 0.31
47 0.28
48 0.26
49 0.23
50 0.18
51 0.13