Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150URN5

Protein Details
Accession A0A150URN5   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPGAIKLRRKKNVKKGIQFCLMVHydrophilic
115-135AEESRIKRNPRFRDNRVHVLLHydrophilic
NLS Segment(s)
PositionSequence
8-14RRKKNVK
Subcellular Location(s) mito 15, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR030379  G_SEPTIN_dom  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF00735  Septin  
PROSITE View protein in PROSITE  
PS51719  G_SEPTIN  
Amino Acid Sequences MPGAIKLRRKKNVKKGIQFCLMVCGASGTGRTTFVNTLCGRPVIEHRDSDDPTTAHEEEGVRIKPITVELELDEEGTRVSLTIVDTPGFGDSIDNEACFGEISAFLERQYDDILAEESRIKRNPRFRDNRVHVLLYFIQPTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.86
4 0.83
5 0.74
6 0.63
7 0.58
8 0.47
9 0.36
10 0.28
11 0.2
12 0.13
13 0.12
14 0.12
15 0.08
16 0.09
17 0.1
18 0.11
19 0.12
20 0.13
21 0.13
22 0.19
23 0.19
24 0.2
25 0.2
26 0.2
27 0.18
28 0.18
29 0.23
30 0.23
31 0.24
32 0.24
33 0.25
34 0.3
35 0.31
36 0.31
37 0.28
38 0.22
39 0.21
40 0.25
41 0.22
42 0.17
43 0.17
44 0.16
45 0.14
46 0.19
47 0.17
48 0.13
49 0.12
50 0.12
51 0.11
52 0.12
53 0.12
54 0.08
55 0.08
56 0.07
57 0.09
58 0.09
59 0.1
60 0.08
61 0.07
62 0.06
63 0.06
64 0.05
65 0.03
66 0.04
67 0.04
68 0.05
69 0.06
70 0.07
71 0.07
72 0.07
73 0.08
74 0.08
75 0.07
76 0.06
77 0.05
78 0.05
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.08
85 0.08
86 0.07
87 0.05
88 0.05
89 0.07
90 0.08
91 0.09
92 0.08
93 0.1
94 0.1
95 0.1
96 0.11
97 0.1
98 0.08
99 0.09
100 0.1
101 0.09
102 0.1
103 0.14
104 0.16
105 0.21
106 0.26
107 0.31
108 0.37
109 0.47
110 0.56
111 0.62
112 0.7
113 0.71
114 0.77
115 0.8
116 0.82
117 0.78
118 0.71
119 0.6
120 0.56
121 0.52
122 0.44