Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A150UPD4

Protein Details
Accession A0A150UPD4    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPSPKRCRSFPKPKVALGKQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.666, nucl 11.5, mito 11.5, cyto_nucl 7.833, cyto_mito 7.833
Family & Domain DBs
Amino Acid Sequences MPSPKRCRSFPKPKVALGKQAPHPTPSPPPPLTISCSAASSSPTFTFTFTFTFPSSSPSPSSSSLGATADGRQPRENGRPARCKKSTSVAHYLMTAAICIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.76
3 0.75
4 0.71
5 0.69
6 0.65
7 0.67
8 0.62
9 0.54
10 0.52
11 0.46
12 0.46
13 0.44
14 0.44
15 0.36
16 0.38
17 0.38
18 0.39
19 0.39
20 0.35
21 0.32
22 0.25
23 0.25
24 0.23
25 0.19
26 0.19
27 0.15
28 0.14
29 0.11
30 0.13
31 0.12
32 0.13
33 0.13
34 0.13
35 0.13
36 0.12
37 0.14
38 0.12
39 0.13
40 0.12
41 0.16
42 0.16
43 0.16
44 0.17
45 0.17
46 0.2
47 0.2
48 0.21
49 0.18
50 0.17
51 0.16
52 0.15
53 0.14
54 0.12
55 0.12
56 0.15
57 0.17
58 0.19
59 0.19
60 0.2
61 0.25
62 0.32
63 0.38
64 0.42
65 0.48
66 0.57
67 0.63
68 0.71
69 0.69
70 0.65
71 0.62
72 0.64
73 0.63
74 0.6
75 0.62
76 0.56
77 0.53
78 0.5
79 0.46
80 0.38
81 0.29