Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A150V8Q7

Protein Details
Accession A0A150V8Q7   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MTHKVAAGGWRRRRRRWQVQQQQQQQQQQLHydrophilic
NLS Segment(s)
PositionSequence
11-15RRRRR
Subcellular Location(s) nucl 14, cyto_nucl 11.5, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MTHKVAAGGWRRRRRRWQVQQQQQQQQQQLPNAILDNALDNFSRRSEYSLSRVKVDIIKQDKDFEGCCSRSTILWKADEAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.87
4 0.88
5 0.89
6 0.93
7 0.94
8 0.93
9 0.91
10 0.87
11 0.81
12 0.74
13 0.67
14 0.6
15 0.52
16 0.44
17 0.35
18 0.29
19 0.23
20 0.19
21 0.14
22 0.1
23 0.09
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.08
30 0.09
31 0.09
32 0.11
33 0.13
34 0.16
35 0.22
36 0.29
37 0.3
38 0.3
39 0.3
40 0.29
41 0.3
42 0.3
43 0.32
44 0.31
45 0.34
46 0.33
47 0.36
48 0.35
49 0.33
50 0.32
51 0.28
52 0.3
53 0.27
54 0.26
55 0.27
56 0.27
57 0.27
58 0.32
59 0.33
60 0.32
61 0.33