Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PBF6

Protein Details
Accession A0A137PBF6    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPFKFARKKKQTEDNTASKLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 11.5, nucl 10.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016137  RGS  
IPR036305  RGS_sf  
IPR044926  RGS_subdomain_2  
Pfam View protein in Pfam  
PF00615  RGS  
Amino Acid Sequences MPFKFARKKKQTEDNTASKLECEAVLDSRGEWRLADFRDFLETVEHSVENLEFCLWFRNYEKRYLSKFNPEAKKQAAVPVVNLLSINPTAGIVPFIKPCDFILNLYTQYTQKTQNKQAFRPKEKKAAFRCPRNLPFSAEIDILVELFFNPSSPIELNLPSGIKKSLLKELNNKTHPDLFKNCYVHVFHLLNASFVAFQTCGKYDKLAEGETDAPSAFTDKVETVEDPSTFQNPTAMAAAPAVNQAVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.71
4 0.62
5 0.52
6 0.43
7 0.33
8 0.25
9 0.18
10 0.15
11 0.14
12 0.16
13 0.15
14 0.15
15 0.18
16 0.19
17 0.18
18 0.16
19 0.16
20 0.2
21 0.22
22 0.25
23 0.21
24 0.2
25 0.25
26 0.25
27 0.22
28 0.2
29 0.18
30 0.17
31 0.18
32 0.17
33 0.13
34 0.13
35 0.13
36 0.11
37 0.11
38 0.09
39 0.07
40 0.07
41 0.13
42 0.12
43 0.15
44 0.18
45 0.27
46 0.28
47 0.36
48 0.41
49 0.42
50 0.48
51 0.53
52 0.54
53 0.55
54 0.6
55 0.62
56 0.65
57 0.61
58 0.61
59 0.56
60 0.55
61 0.45
62 0.43
63 0.39
64 0.3
65 0.28
66 0.26
67 0.24
68 0.21
69 0.2
70 0.14
71 0.11
72 0.1
73 0.1
74 0.06
75 0.06
76 0.05
77 0.06
78 0.07
79 0.06
80 0.08
81 0.09
82 0.11
83 0.11
84 0.11
85 0.12
86 0.14
87 0.13
88 0.13
89 0.13
90 0.14
91 0.14
92 0.15
93 0.15
94 0.12
95 0.14
96 0.15
97 0.21
98 0.25
99 0.31
100 0.38
101 0.44
102 0.48
103 0.53
104 0.61
105 0.63
106 0.66
107 0.68
108 0.63
109 0.66
110 0.66
111 0.68
112 0.66
113 0.67
114 0.66
115 0.67
116 0.69
117 0.68
118 0.69
119 0.65
120 0.59
121 0.52
122 0.46
123 0.4
124 0.35
125 0.26
126 0.21
127 0.17
128 0.15
129 0.11
130 0.08
131 0.06
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.06
139 0.07
140 0.08
141 0.09
142 0.1
143 0.11
144 0.12
145 0.13
146 0.11
147 0.12
148 0.11
149 0.12
150 0.13
151 0.15
152 0.22
153 0.27
154 0.3
155 0.38
156 0.47
157 0.55
158 0.56
159 0.56
160 0.51
161 0.52
162 0.5
163 0.47
164 0.44
165 0.38
166 0.42
167 0.42
168 0.4
169 0.37
170 0.37
171 0.33
172 0.34
173 0.3
174 0.24
175 0.28
176 0.27
177 0.23
178 0.21
179 0.2
180 0.13
181 0.12
182 0.13
183 0.07
184 0.08
185 0.1
186 0.12
187 0.14
188 0.14
189 0.16
190 0.16
191 0.2
192 0.23
193 0.21
194 0.2
195 0.21
196 0.23
197 0.21
198 0.21
199 0.16
200 0.13
201 0.13
202 0.14
203 0.11
204 0.09
205 0.11
206 0.1
207 0.13
208 0.15
209 0.15
210 0.17
211 0.2
212 0.2
213 0.2
214 0.22
215 0.22
216 0.21
217 0.2
218 0.19
219 0.15
220 0.17
221 0.17
222 0.15
223 0.13
224 0.14
225 0.14
226 0.13
227 0.13