Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137P6F1

Protein Details
Accession A0A137P6F1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-32SLSFKGEKGIKKKSKKSKLKVESVKDLKHydrophilic
NLS Segment(s)
PositionSequence
9-24KGEKGIKKKSKKSKLK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences MGKGSLSFKGEKGIKKKSKKSKLKVESVKDLKDDFTQVKTESELKFEKIQQERMKEKIKEVSKHSHKDKVAEFNAKLSNLSEHYDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.75
4 0.78
5 0.83
6 0.87
7 0.89
8 0.89
9 0.89
10 0.89
11 0.89
12 0.84
13 0.84
14 0.78
15 0.71
16 0.61
17 0.53
18 0.44
19 0.35
20 0.32
21 0.23
22 0.19
23 0.18
24 0.17
25 0.17
26 0.17
27 0.2
28 0.17
29 0.2
30 0.19
31 0.19
32 0.21
33 0.22
34 0.27
35 0.26
36 0.33
37 0.34
38 0.4
39 0.41
40 0.44
41 0.51
42 0.45
43 0.45
44 0.46
45 0.48
46 0.47
47 0.49
48 0.53
49 0.54
50 0.62
51 0.64
52 0.64
53 0.58
54 0.59
55 0.59
56 0.58
57 0.55
58 0.54
59 0.49
60 0.46
61 0.48
62 0.43
63 0.38
64 0.3
65 0.27
66 0.22
67 0.24
68 0.21
69 0.2
70 0.23
71 0.25
72 0.24