Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137P8L7

Protein Details
Accession A0A137P8L7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MSKSKNHTNHNQNKKAHRNGIRKPKQHRFSSKRHydrophilic
NLS Segment(s)
PositionSequence
14-50KKAHRNGIRKPKQHRFSSKRGVDPKFLRNLRFAKKGS
Subcellular Location(s) nucl 12.5, mito_nucl 12.333, mito 10, cyto_nucl 9.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQNKKAHRNGIRKPKQHRFSSKRGVDPKFLRNLRFAKKGSWTARVAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.81
4 0.81
5 0.79
6 0.8
7 0.84
8 0.83
9 0.81
10 0.82
11 0.83
12 0.81
13 0.8
14 0.82
15 0.77
16 0.77
17 0.79
18 0.75
19 0.73
20 0.72
21 0.67
22 0.64
23 0.62
24 0.59
25 0.58
26 0.56
27 0.5
28 0.49
29 0.54
30 0.53
31 0.55
32 0.51
33 0.46
34 0.5
35 0.58
36 0.56
37 0.55
38 0.5