Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PGL9

Protein Details
Accession A0A137PGL9    Localization Confidence High Confidence Score 24.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MGRLARSRKHRGIRDIKRKYRLRRRTKDLDQIHEDBasic
74-94LVEHRRGKYHKKRLRLLKDAPBasic
107-130GTDNGKRLNAKKKAEKEEKVKDMEBasic
NLS Segment(s)
PositionSequence
5-26ARSRKHRGIRDIKRKYRLRRRT
79-87RGKYHKKRL
116-121AKKKAE
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000690  Matrin/U1-C_Znf_C2H2  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0003676  F:nucleic acid binding  
GO:0043023  F:ribosomal large subunit binding  
GO:0008270  F:zinc ion binding  
GO:0000055  P:ribosomal large subunit export from nucleus  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS50171  ZF_MATRIN  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLARSRKHRGIRDIKRKYRLRRRTKDLDQIHEDLEPEKATHLEKQEVDPDLPGLAQHYCIQCSKYFTDDKSLVEHRRGKYHKKRLRLLKDAPYTIKEAEMAAGLGTDNGKRLNAKKKAEKEEKVKDMETD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.88
4 0.89
5 0.9
6 0.9
7 0.9
8 0.9
9 0.9
10 0.89
11 0.89
12 0.89
13 0.89
14 0.88
15 0.84
16 0.81
17 0.76
18 0.67
19 0.59
20 0.49
21 0.41
22 0.31
23 0.25
24 0.17
25 0.11
26 0.1
27 0.1
28 0.1
29 0.13
30 0.16
31 0.19
32 0.19
33 0.21
34 0.24
35 0.25
36 0.24
37 0.2
38 0.17
39 0.13
40 0.12
41 0.1
42 0.07
43 0.06
44 0.07
45 0.09
46 0.1
47 0.11
48 0.12
49 0.13
50 0.13
51 0.16
52 0.16
53 0.17
54 0.19
55 0.18
56 0.23
57 0.23
58 0.23
59 0.24
60 0.28
61 0.26
62 0.31
63 0.37
64 0.32
65 0.4
66 0.44
67 0.51
68 0.57
69 0.66
70 0.66
71 0.68
72 0.76
73 0.77
74 0.82
75 0.8
76 0.76
77 0.75
78 0.75
79 0.7
80 0.63
81 0.55
82 0.48
83 0.39
84 0.33
85 0.23
86 0.17
87 0.13
88 0.11
89 0.09
90 0.06
91 0.06
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.08
98 0.09
99 0.13
100 0.2
101 0.3
102 0.39
103 0.48
104 0.56
105 0.65
106 0.75
107 0.81
108 0.84
109 0.83
110 0.85
111 0.83
112 0.79