Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137P3Y6

Protein Details
Accession A0A137P3Y6    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSSRTGGQKKKAQRHKNDYAYIHQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019351  DUF2039  
Pfam View protein in Pfam  
PF10217  DUF2039  
Amino Acid Sequences MSSRTGGQKKKAQRHKNDYAYIHQKQSALTQKISQLPVHGLCSRCVEQILWRKQFGKYKPLSVAKKCVGCQMKTVKEAYHILCNPCAKAKKVCAKCQTTNEIVTDPSEYKTDAQTAAEQQNYDNWLRSLPERKRRTVLRKIERGEDVQVGEVESDDDLDFGSDLDDDFDSDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.89
4 0.87
5 0.8
6 0.79
7 0.78
8 0.71
9 0.66
10 0.58
11 0.49
12 0.42
13 0.46
14 0.46
15 0.4
16 0.37
17 0.36
18 0.38
19 0.43
20 0.44
21 0.37
22 0.29
23 0.29
24 0.29
25 0.3
26 0.29
27 0.25
28 0.24
29 0.29
30 0.29
31 0.25
32 0.24
33 0.2
34 0.24
35 0.33
36 0.41
37 0.39
38 0.4
39 0.41
40 0.45
41 0.52
42 0.48
43 0.48
44 0.42
45 0.43
46 0.48
47 0.55
48 0.57
49 0.53
50 0.57
51 0.51
52 0.52
53 0.48
54 0.48
55 0.44
56 0.37
57 0.4
58 0.41
59 0.4
60 0.39
61 0.39
62 0.31
63 0.3
64 0.33
65 0.28
66 0.27
67 0.25
68 0.24
69 0.26
70 0.26
71 0.23
72 0.25
73 0.25
74 0.21
75 0.22
76 0.29
77 0.35
78 0.41
79 0.48
80 0.52
81 0.57
82 0.59
83 0.61
84 0.58
85 0.51
86 0.47
87 0.4
88 0.32
89 0.26
90 0.21
91 0.18
92 0.14
93 0.12
94 0.11
95 0.11
96 0.11
97 0.12
98 0.12
99 0.11
100 0.11
101 0.12
102 0.16
103 0.18
104 0.19
105 0.18
106 0.16
107 0.18
108 0.2
109 0.19
110 0.17
111 0.14
112 0.14
113 0.15
114 0.2
115 0.27
116 0.33
117 0.43
118 0.47
119 0.51
120 0.58
121 0.66
122 0.71
123 0.72
124 0.74
125 0.74
126 0.77
127 0.76
128 0.75
129 0.69
130 0.62
131 0.55
132 0.47
133 0.37
134 0.29
135 0.26
136 0.2
137 0.16
138 0.14
139 0.11
140 0.08
141 0.08
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.05
148 0.06
149 0.05
150 0.05
151 0.07
152 0.07
153 0.07