Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PCX9

Protein Details
Accession A0A137PCX9    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-46KSANHHHHSNHKKDHKDHSSNBasic
NLS Segment(s)
Subcellular Location(s) extr 17, E.R. 4, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
CDD cd22785  DPBB_MltA-like  
Amino Acid Sequences MLLINLLIYLLVSALYSAHHHNETSKSANHHHHSNHKKDHKDHSSNGGNKNYKKIKLTYYWITKESLFPEGKDKEIKVCSSDGEKGDKVISKVSPEFYESLHTEGTGKLRDGKFVNCGNDDCTCFNKVPGPQGNKGDILNIYTSVASKSLKVGTKIYIKEFDGFKLPSGELHNGCVKVEDTGYGLERDQIDLFSYYKANYERVNKDLRLESVKVKIGSNCKVKAYSTKIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.07
4 0.1
5 0.14
6 0.16
7 0.16
8 0.2
9 0.24
10 0.28
11 0.31
12 0.32
13 0.33
14 0.38
15 0.47
16 0.48
17 0.51
18 0.53
19 0.59
20 0.65
21 0.69
22 0.73
23 0.73
24 0.77
25 0.76
26 0.81
27 0.81
28 0.79
29 0.73
30 0.71
31 0.72
32 0.7
33 0.71
34 0.69
35 0.65
36 0.6
37 0.65
38 0.63
39 0.58
40 0.56
41 0.53
42 0.5
43 0.49
44 0.54
45 0.53
46 0.55
47 0.54
48 0.51
49 0.49
50 0.43
51 0.39
52 0.34
53 0.32
54 0.24
55 0.21
56 0.27
57 0.27
58 0.29
59 0.29
60 0.28
61 0.26
62 0.29
63 0.29
64 0.23
65 0.22
66 0.21
67 0.22
68 0.25
69 0.21
70 0.22
71 0.22
72 0.2
73 0.22
74 0.22
75 0.2
76 0.19
77 0.17
78 0.16
79 0.18
80 0.18
81 0.17
82 0.17
83 0.17
84 0.14
85 0.17
86 0.15
87 0.15
88 0.13
89 0.12
90 0.11
91 0.12
92 0.13
93 0.11
94 0.1
95 0.15
96 0.15
97 0.18
98 0.19
99 0.19
100 0.22
101 0.25
102 0.26
103 0.21
104 0.22
105 0.2
106 0.21
107 0.21
108 0.18
109 0.16
110 0.16
111 0.15
112 0.15
113 0.17
114 0.17
115 0.22
116 0.27
117 0.31
118 0.33
119 0.36
120 0.37
121 0.34
122 0.33
123 0.27
124 0.21
125 0.17
126 0.13
127 0.11
128 0.09
129 0.08
130 0.08
131 0.07
132 0.08
133 0.08
134 0.07
135 0.09
136 0.13
137 0.16
138 0.18
139 0.19
140 0.22
141 0.29
142 0.31
143 0.32
144 0.3
145 0.29
146 0.31
147 0.3
148 0.27
149 0.25
150 0.24
151 0.22
152 0.21
153 0.19
154 0.18
155 0.21
156 0.25
157 0.2
158 0.23
159 0.26
160 0.24
161 0.24
162 0.22
163 0.19
164 0.15
165 0.15
166 0.12
167 0.09
168 0.11
169 0.12
170 0.12
171 0.11
172 0.13
173 0.13
174 0.15
175 0.14
176 0.12
177 0.13
178 0.14
179 0.14
180 0.13
181 0.14
182 0.12
183 0.16
184 0.18
185 0.19
186 0.23
187 0.31
188 0.34
189 0.38
190 0.45
191 0.42
192 0.45
193 0.47
194 0.45
195 0.43
196 0.41
197 0.4
198 0.4
199 0.45
200 0.41
201 0.4
202 0.41
203 0.43
204 0.48
205 0.52
206 0.49
207 0.47
208 0.48
209 0.48
210 0.51