Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PCX9

Protein Details
Accession A0A137PCX9   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-46KSANHHHHSNHKKDHKDHSSNBasic
NLS Segment(s)
Subcellular Location(s) extr 17, E.R. 4, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
CDD cd22785  DPBB_MltA-like  
Amino Acid Sequences MLLINLLIYLLVSALYSAHHHNETSKSANHHHHSNHKKDHKDHSSNGGNKNYKKIKLTYYWITKESLFPEGKDKEIKVCSSDGEKGDKVISKVSPEFYESLHTEGTGKLRDGKFVNCGNDDCTCFNKVPGPQGNKGDILNIYTSVASKSLKVGTKIYIKEFDGFKLPSGELHNGCVKVEDTGYGLERDQIDLFSYYKANYERVNKDLRLESVKVKIGSNCKVKAYSTKIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.07
4 0.1
5 0.14
6 0.16
7 0.16
8 0.2
9 0.24
10 0.28
11 0.31
12 0.32
13 0.33
14 0.38
15 0.47
16 0.48
17 0.51
18 0.53
19 0.59
20 0.65
21 0.69
22 0.73
23 0.73
24 0.77
25 0.76
26 0.81
27 0.81
28 0.79
29 0.73
30 0.71
31 0.72
32 0.7
33 0.71
34 0.69
35 0.65
36 0.6
37 0.65
38 0.63
39 0.58
40 0.56
41 0.53
42 0.5
43 0.49
44 0.54
45 0.53
46 0.55
47 0.54
48 0.51
49 0.49
50 0.43
51 0.39
52 0.34
53 0.32
54 0.24
55 0.21
56 0.27
57 0.27
58 0.29
59 0.29
60 0.28
61 0.26
62 0.29
63 0.29
64 0.23
65 0.22
66 0.21
67 0.22
68 0.25
69 0.21
70 0.22
71 0.22
72 0.2
73 0.22
74 0.22
75 0.2
76 0.19
77 0.17
78 0.16
79 0.18
80 0.18
81 0.17
82 0.17
83 0.17
84 0.14
85 0.17
86 0.15
87 0.15
88 0.13
89 0.12
90 0.11
91 0.12
92 0.13
93 0.11
94 0.1
95 0.15
96 0.15
97 0.18
98 0.19
99 0.19
100 0.22
101 0.25
102 0.26
103 0.21
104 0.22
105 0.2
106 0.21
107 0.21
108 0.18
109 0.16
110 0.16
111 0.15
112 0.15
113 0.17
114 0.17
115 0.22
116 0.27
117 0.31
118 0.33
119 0.36
120 0.37
121 0.34
122 0.33
123 0.27
124 0.21
125 0.17
126 0.13
127 0.11
128 0.09
129 0.08
130 0.08
131 0.07
132 0.08
133 0.08
134 0.07
135 0.09
136 0.13
137 0.16
138 0.18
139 0.19
140 0.22
141 0.29
142 0.31
143 0.32
144 0.3
145 0.29
146 0.31
147 0.3
148 0.27
149 0.25
150 0.24
151 0.22
152 0.21
153 0.19
154 0.18
155 0.21
156 0.25
157 0.2
158 0.23
159 0.26
160 0.24
161 0.24
162 0.22
163 0.19
164 0.15
165 0.15
166 0.12
167 0.09
168 0.11
169 0.12
170 0.12
171 0.11
172 0.13
173 0.13
174 0.15
175 0.14
176 0.12
177 0.13
178 0.14
179 0.14
180 0.13
181 0.14
182 0.12
183 0.16
184 0.18
185 0.19
186 0.23
187 0.31
188 0.34
189 0.38
190 0.45
191 0.42
192 0.45
193 0.47
194 0.45
195 0.43
196 0.41
197 0.4
198 0.4
199 0.45
200 0.41
201 0.4
202 0.41
203 0.43
204 0.48
205 0.52
206 0.49
207 0.47
208 0.48
209 0.48
210 0.51