Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PA43

Protein Details
Accession A0A137PA43    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
59-88VDQSTTNTNKKKKKNKNKNKKNNTNTNEGEHydrophilic
NLS Segment(s)
PositionSequence
68-79KKKKKNKNKNKK
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 7
Family & Domain DBs
Amino Acid Sequences MSIPNLFKVPGWNLPSDIKIEKDPKKNNSNEVVNKVESVKVEAKPIATTTNKREIEETVDQSTTNTNKKKKKNKNKNKKNNTNTNEGENNLVNISFTEKIEEQKPTELSEVNEEVKEEKISN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.32
4 0.3
5 0.24
6 0.28
7 0.35
8 0.41
9 0.48
10 0.55
11 0.59
12 0.67
13 0.68
14 0.68
15 0.68
16 0.68
17 0.65
18 0.62
19 0.57
20 0.48
21 0.45
22 0.39
23 0.33
24 0.24
25 0.23
26 0.21
27 0.18
28 0.2
29 0.2
30 0.2
31 0.18
32 0.19
33 0.19
34 0.18
35 0.21
36 0.24
37 0.33
38 0.33
39 0.33
40 0.33
41 0.3
42 0.32
43 0.32
44 0.3
45 0.22
46 0.21
47 0.2
48 0.2
49 0.21
50 0.18
51 0.2
52 0.24
53 0.3
54 0.38
55 0.48
56 0.59
57 0.67
58 0.76
59 0.82
60 0.87
61 0.91
62 0.94
63 0.96
64 0.97
65 0.96
66 0.94
67 0.94
68 0.87
69 0.84
70 0.74
71 0.69
72 0.6
73 0.5
74 0.43
75 0.32
76 0.28
77 0.2
78 0.18
79 0.11
80 0.09
81 0.12
82 0.1
83 0.1
84 0.13
85 0.14
86 0.18
87 0.21
88 0.25
89 0.24
90 0.28
91 0.29
92 0.28
93 0.29
94 0.28
95 0.26
96 0.28
97 0.29
98 0.26
99 0.25
100 0.24
101 0.23
102 0.23