Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PIS1

Protein Details
Accession A0A137PIS1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-33IPKTRNTFCKGKTCRKHTPHKVTQYKTGKAHydrophilic
NLS Segment(s)
PositionSequence
55-64KPVFKKKAKT
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRNTFCKGKTCRKHTPHKVTQYKTGKASLFAQGKRRYDRKQSGFGGQTKPVFKKKAKTTKKVVLRLECSVCKYKQQLPLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.75
4 0.8
5 0.81
6 0.86
7 0.86
8 0.88
9 0.87
10 0.88
11 0.89
12 0.82
13 0.83
14 0.8
15 0.74
16 0.66
17 0.61
18 0.51
19 0.43
20 0.42
21 0.39
22 0.37
23 0.36
24 0.41
25 0.43
26 0.47
27 0.51
28 0.55
29 0.53
30 0.56
31 0.63
32 0.6
33 0.61
34 0.59
35 0.58
36 0.56
37 0.55
38 0.48
39 0.41
40 0.38
41 0.33
42 0.34
43 0.34
44 0.34
45 0.33
46 0.39
47 0.46
48 0.54
49 0.6
50 0.65
51 0.68
52 0.72
53 0.78
54 0.78
55 0.74
56 0.71
57 0.66
58 0.63
59 0.59
60 0.52
61 0.48
62 0.45
63 0.39
64 0.37
65 0.38
66 0.39
67 0.44
68 0.52
69 0.57
70 0.59
71 0.7
72 0.73
73 0.76
74 0.74
75 0.7
76 0.66
77 0.61
78 0.6
79 0.6
80 0.6
81 0.6
82 0.61
83 0.56
84 0.51
85 0.48
86 0.42