Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137NT88

Protein Details
Accession A0A137NT88   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-56EEKMLRRKIALNDKHKKNKNSTHNPDKSKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022816  Condensin_barren_su2  
Gene Ontology GO:0000796  C:condensin complex  
GO:0005737  C:cytoplasm  
GO:0051301  P:cell division  
GO:0007076  P:mitotic chromosome condensation  
Pfam View protein in Pfam  
PF05786  Cnd2  
Amino Acid Sequences MSKFTNNHNLSFNQSSFFNTSMNNDLEEKMLRRKIALNDKHKKNKNSTHNPDKSKIINRMDTHDTTMSGGTPLPALNTLSVEEINKRYEEWMKIAADNKINSTNTWNFALIDYFHELSLFRDGDTINFQKASCTLDGCMKIYSSRVDSAATETGRLLNGLVDNNIKDLDTINEELDAETGEKPKRKANRSEQTLAKDFTQLTVKQFDLEFSVDPLFKKTSADFDEGGARGLLLNHLSIQGDVHLPFTKRFPTWSGYNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.3
4 0.29
5 0.23
6 0.19
7 0.21
8 0.25
9 0.25
10 0.23
11 0.22
12 0.21
13 0.22
14 0.25
15 0.24
16 0.27
17 0.3
18 0.29
19 0.29
20 0.34
21 0.41
22 0.49
23 0.55
24 0.58
25 0.65
26 0.75
27 0.83
28 0.86
29 0.85
30 0.84
31 0.84
32 0.84
33 0.85
34 0.85
35 0.86
36 0.86
37 0.85
38 0.79
39 0.74
40 0.7
41 0.67
42 0.66
43 0.61
44 0.59
45 0.55
46 0.56
47 0.57
48 0.51
49 0.47
50 0.39
51 0.33
52 0.26
53 0.24
54 0.19
55 0.13
56 0.12
57 0.08
58 0.08
59 0.07
60 0.06
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.09
67 0.09
68 0.09
69 0.11
70 0.13
71 0.14
72 0.13
73 0.13
74 0.15
75 0.19
76 0.2
77 0.19
78 0.22
79 0.21
80 0.23
81 0.25
82 0.26
83 0.26
84 0.24
85 0.24
86 0.24
87 0.23
88 0.21
89 0.24
90 0.23
91 0.22
92 0.23
93 0.21
94 0.17
95 0.17
96 0.17
97 0.12
98 0.12
99 0.12
100 0.11
101 0.1
102 0.1
103 0.1
104 0.1
105 0.13
106 0.11
107 0.09
108 0.09
109 0.09
110 0.1
111 0.14
112 0.14
113 0.11
114 0.12
115 0.12
116 0.11
117 0.12
118 0.13
119 0.09
120 0.09
121 0.09
122 0.12
123 0.14
124 0.14
125 0.14
126 0.12
127 0.12
128 0.12
129 0.13
130 0.11
131 0.11
132 0.11
133 0.11
134 0.11
135 0.14
136 0.16
137 0.15
138 0.13
139 0.12
140 0.12
141 0.12
142 0.11
143 0.09
144 0.06
145 0.07
146 0.07
147 0.08
148 0.08
149 0.08
150 0.09
151 0.09
152 0.08
153 0.07
154 0.07
155 0.08
156 0.1
157 0.11
158 0.1
159 0.1
160 0.11
161 0.1
162 0.1
163 0.09
164 0.07
165 0.07
166 0.11
167 0.15
168 0.19
169 0.2
170 0.27
171 0.35
172 0.41
173 0.51
174 0.57
175 0.64
176 0.69
177 0.74
178 0.73
179 0.71
180 0.68
181 0.6
182 0.5
183 0.42
184 0.34
185 0.29
186 0.29
187 0.24
188 0.22
189 0.24
190 0.23
191 0.22
192 0.22
193 0.21
194 0.18
195 0.18
196 0.15
197 0.14
198 0.16
199 0.15
200 0.16
201 0.18
202 0.17
203 0.16
204 0.18
205 0.17
206 0.22
207 0.25
208 0.28
209 0.26
210 0.26
211 0.31
212 0.29
213 0.29
214 0.21
215 0.16
216 0.13
217 0.13
218 0.13
219 0.08
220 0.09
221 0.08
222 0.1
223 0.1
224 0.1
225 0.1
226 0.1
227 0.12
228 0.11
229 0.14
230 0.17
231 0.19
232 0.2
233 0.24
234 0.28
235 0.26
236 0.3
237 0.3
238 0.32