Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PEF7

Protein Details
Accession A0A137PEF7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-45TTPRELKQRPSQRRALPKKRTRFVRDLHydrophilic
61-82ELLKNSKDKRARKLAKKRLGTLHydrophilic
NLS Segment(s)
PositionSequence
24-40LKQRPSQRRALPKKRTR
65-88NSKDKRARKLAKKRLGTLVRAKKK
Subcellular Location(s) mito 14.5, cyto_mito 10, nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAVAQRTGFIIGKNKGHITTPRELKQRPSQRRALPKKRTRFVRDLVREVVGFAPYERRVMELLKNSKDKRARKLAKKRLGTLVRAKKKVEELSNIIAESRRAQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.35
4 0.38
5 0.37
6 0.41
7 0.46
8 0.49
9 0.54
10 0.55
11 0.58
12 0.62
13 0.67
14 0.68
15 0.67
16 0.68
17 0.69
18 0.79
19 0.82
20 0.83
21 0.83
22 0.82
23 0.85
24 0.85
25 0.86
26 0.82
27 0.77
28 0.74
29 0.73
30 0.69
31 0.63
32 0.57
33 0.49
34 0.41
35 0.35
36 0.29
37 0.18
38 0.13
39 0.09
40 0.1
41 0.09
42 0.1
43 0.1
44 0.1
45 0.11
46 0.12
47 0.16
48 0.21
49 0.26
50 0.31
51 0.38
52 0.38
53 0.45
54 0.52
55 0.54
56 0.54
57 0.6
58 0.64
59 0.68
60 0.79
61 0.82
62 0.83
63 0.84
64 0.8
65 0.79
66 0.74
67 0.7
68 0.69
69 0.69
70 0.69
71 0.67
72 0.64
73 0.58
74 0.6
75 0.61
76 0.56
77 0.52
78 0.48
79 0.5
80 0.51
81 0.47
82 0.4
83 0.33
84 0.29