Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PCA1

Protein Details
Accession A0A137PCA1    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-104LCTVKNPKFMKYRRPNQRKWESHVEFHydrophilic
308-329SSPSTDKKSKKSQSSAGKKFEDHydrophilic
348-374ENPELEDKFKRREKRLKKYGNEESPIKBasic
NLS Segment(s)
PositionSequence
357-365KRREKRLKK
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR030393  G_ENGB_dom  
IPR006073  GTP-bd  
IPR019987  GTP-bd_ribosome_bio_YsxC  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
Gene Ontology GO:0005525  F:GTP binding  
GO:0016787  F:hydrolase activity  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
PROSITE View protein in PROSITE  
PS51706  G_ENGB  
CDD cd01876  YihA_EngB  
Amino Acid Sequences MLNLIFRSSLRAINPTKSLTTRIIPSLQLTSSYTTSSKNSTTVAELRAQASEEGISNRKKFMSYQPNDKTFELIDKLGLCTVKNPKFMKYRRPNQRKWESHVEFPILQFFAGAKSAASFPEDSLPEIAVVGRSNVGKSKLINSLCSSAVVRTSDRPGVTKQLNFYEAHDQFHLVDMPGYGFAYAKEEVKASWSKLIEDYLTTRKSFKILLVLVDGRHTLKPADKEFMNMLEEKKIKYQVVVTKCDLLVRSVLARNFELIQNDLKSYKYANQRLIPLSSVTFAGVNELRKFLLHTVGIRNSPTKKSSDSSPSTDKKSKKSQSSAGKKFEDSIDDKKRQEDRQKFLQIQENPELEDKFKRREKRLKKYGNEESPIKGLYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.42
4 0.4
5 0.42
6 0.38
7 0.39
8 0.38
9 0.38
10 0.37
11 0.34
12 0.35
13 0.34
14 0.3
15 0.27
16 0.25
17 0.24
18 0.22
19 0.24
20 0.22
21 0.21
22 0.23
23 0.25
24 0.25
25 0.23
26 0.23
27 0.22
28 0.27
29 0.28
30 0.28
31 0.29
32 0.29
33 0.28
34 0.27
35 0.26
36 0.21
37 0.18
38 0.16
39 0.13
40 0.15
41 0.2
42 0.25
43 0.25
44 0.27
45 0.28
46 0.28
47 0.3
48 0.36
49 0.42
50 0.43
51 0.52
52 0.59
53 0.64
54 0.67
55 0.63
56 0.55
57 0.45
58 0.43
59 0.35
60 0.26
61 0.22
62 0.19
63 0.19
64 0.2
65 0.19
66 0.15
67 0.18
68 0.27
69 0.31
70 0.38
71 0.39
72 0.43
73 0.53
74 0.59
75 0.64
76 0.65
77 0.7
78 0.73
79 0.82
80 0.84
81 0.85
82 0.9
83 0.86
84 0.83
85 0.84
86 0.77
87 0.72
88 0.67
89 0.6
90 0.5
91 0.43
92 0.39
93 0.27
94 0.23
95 0.17
96 0.14
97 0.1
98 0.1
99 0.1
100 0.06
101 0.07
102 0.08
103 0.08
104 0.09
105 0.09
106 0.09
107 0.13
108 0.14
109 0.14
110 0.14
111 0.14
112 0.12
113 0.12
114 0.11
115 0.07
116 0.07
117 0.06
118 0.07
119 0.07
120 0.08
121 0.11
122 0.13
123 0.14
124 0.14
125 0.18
126 0.23
127 0.24
128 0.26
129 0.25
130 0.26
131 0.24
132 0.24
133 0.21
134 0.14
135 0.16
136 0.15
137 0.14
138 0.13
139 0.16
140 0.18
141 0.18
142 0.2
143 0.19
144 0.24
145 0.26
146 0.26
147 0.25
148 0.25
149 0.26
150 0.25
151 0.26
152 0.29
153 0.26
154 0.26
155 0.24
156 0.22
157 0.19
158 0.2
159 0.18
160 0.09
161 0.08
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.04
168 0.04
169 0.07
170 0.07
171 0.08
172 0.08
173 0.08
174 0.08
175 0.12
176 0.13
177 0.11
178 0.15
179 0.14
180 0.15
181 0.15
182 0.16
183 0.13
184 0.12
185 0.15
186 0.16
187 0.17
188 0.17
189 0.18
190 0.17
191 0.18
192 0.18
193 0.16
194 0.16
195 0.15
196 0.15
197 0.17
198 0.18
199 0.17
200 0.17
201 0.16
202 0.12
203 0.12
204 0.11
205 0.1
206 0.12
207 0.17
208 0.19
209 0.22
210 0.2
211 0.22
212 0.22
213 0.23
214 0.21
215 0.18
216 0.17
217 0.19
218 0.2
219 0.19
220 0.22
221 0.23
222 0.21
223 0.21
224 0.26
225 0.27
226 0.31
227 0.35
228 0.33
229 0.33
230 0.33
231 0.33
232 0.28
233 0.21
234 0.17
235 0.13
236 0.15
237 0.15
238 0.16
239 0.17
240 0.17
241 0.17
242 0.18
243 0.18
244 0.17
245 0.15
246 0.17
247 0.16
248 0.17
249 0.16
250 0.15
251 0.14
252 0.15
253 0.2
254 0.27
255 0.32
256 0.37
257 0.4
258 0.45
259 0.47
260 0.46
261 0.4
262 0.32
263 0.27
264 0.21
265 0.18
266 0.13
267 0.11
268 0.09
269 0.12
270 0.13
271 0.16
272 0.16
273 0.17
274 0.16
275 0.16
276 0.18
277 0.15
278 0.18
279 0.16
280 0.18
281 0.24
282 0.28
283 0.29
284 0.3
285 0.34
286 0.33
287 0.36
288 0.35
289 0.32
290 0.33
291 0.33
292 0.38
293 0.43
294 0.44
295 0.46
296 0.53
297 0.55
298 0.59
299 0.64
300 0.63
301 0.61
302 0.67
303 0.7
304 0.7
305 0.72
306 0.73
307 0.76
308 0.82
309 0.83
310 0.81
311 0.75
312 0.66
313 0.61
314 0.55
315 0.5
316 0.44
317 0.45
318 0.47
319 0.5
320 0.5
321 0.55
322 0.61
323 0.63
324 0.69
325 0.69
326 0.66
327 0.7
328 0.78
329 0.74
330 0.73
331 0.73
332 0.67
333 0.64
334 0.64
335 0.55
336 0.48
337 0.47
338 0.43
339 0.36
340 0.4
341 0.38
342 0.4
343 0.47
344 0.54
345 0.61
346 0.71
347 0.8
348 0.82
349 0.88
350 0.89
351 0.9
352 0.92
353 0.92
354 0.91
355 0.86
356 0.78
357 0.71
358 0.64