Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PBL1

Protein Details
Accession A0A137PBL1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-131VVEAKVTARKQRKERKNRAKKFRGKEKAKVLKSSAHydrophilic
NLS Segment(s)
PositionSequence
87-129EPRHRLARHGVVEAKVTARKQRKERKNRAKKFRGKEKAKVLKS
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDNSITIRTKKFLSNPLLQRKQMVAEVIHPGRANCSKEEIREKLAKIFKSDKENIFVFGFKTVFGGSRSTGFALIYDSLDAAKKFEPRHRLARHGVVEAKVTARKQRKERKNRAKKFRGKEKAKVLKSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.57
4 0.66
5 0.7
6 0.65
7 0.62
8 0.54
9 0.5
10 0.43
11 0.36
12 0.25
13 0.21
14 0.28
15 0.26
16 0.27
17 0.24
18 0.22
19 0.25
20 0.29
21 0.28
22 0.21
23 0.28
24 0.27
25 0.33
26 0.4
27 0.38
28 0.38
29 0.41
30 0.41
31 0.42
32 0.45
33 0.41
34 0.38
35 0.42
36 0.4
37 0.43
38 0.47
39 0.41
40 0.4
41 0.39
42 0.37
43 0.31
44 0.27
45 0.2
46 0.16
47 0.14
48 0.1
49 0.1
50 0.08
51 0.08
52 0.09
53 0.09
54 0.08
55 0.09
56 0.1
57 0.1
58 0.1
59 0.09
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.09
71 0.13
72 0.16
73 0.22
74 0.3
75 0.34
76 0.44
77 0.47
78 0.51
79 0.53
80 0.58
81 0.55
82 0.51
83 0.49
84 0.4
85 0.37
86 0.31
87 0.29
88 0.24
89 0.23
90 0.28
91 0.34
92 0.41
93 0.5
94 0.6
95 0.69
96 0.77
97 0.87
98 0.89
99 0.92
100 0.94
101 0.95
102 0.95
103 0.94
104 0.94
105 0.94
106 0.93
107 0.9
108 0.89
109 0.89
110 0.89
111 0.85