Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137P9G3

Protein Details
Accession A0A137P9G3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-24ANQVIKIKKLKVKPKKAAAMGQHydrophilic
NLS Segment(s)
PositionSequence
10-18KKLKVKPKK
Subcellular Location(s) mito 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSANQVIKIKKLKVKPKKAAAMGQCVPEMTALLNCWSSLSIEHPRCTASASTLAMCMSNAKPAPKVPNTLNYHLNRLGKNLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.81
4 0.83
5 0.8
6 0.79
7 0.72
8 0.7
9 0.61
10 0.53
11 0.44
12 0.35
13 0.3
14 0.22
15 0.18
16 0.09
17 0.08
18 0.06
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.06
26 0.1
27 0.17
28 0.19
29 0.2
30 0.21
31 0.21
32 0.21
33 0.22
34 0.18
35 0.12
36 0.13
37 0.13
38 0.13
39 0.13
40 0.13
41 0.11
42 0.11
43 0.12
44 0.09
45 0.13
46 0.15
47 0.16
48 0.17
49 0.21
50 0.29
51 0.29
52 0.34
53 0.33
54 0.41
55 0.46
56 0.49
57 0.54
58 0.49
59 0.52
60 0.53
61 0.55
62 0.46
63 0.43