Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137NSW3

Protein Details
Accession A0A137NSW3    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
234-253YSYKGCKNRRFEESQKQKIRHydrophilic
NLS Segment(s)
PositionSequence
174-186IKLKSKKAGKKSK
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Pfam View protein in Pfam  
PF13412  HTH_24  
Amino Acid Sequences MSDKKPASSVHRIPDEFLIDLVNENPDLNMAELGKLAGTTATIISMRLREINYDGERVKYIHKPTGKTKTFTDDYLISLANENPDSTVKELSTLVGASFSSVLRRVKQINSSEERIKCKPKNVGKPKKFTDESLITLANENPDISLTELSSLVGASITAVSRRIDQINSFEEKIKLKSKKAGKKSKITDELILNLLNENPDLKMQELGKLVGVSVSAISHRLTKMKNNGIRLQYSYKGCKNRRFEESQKQKIRVSNQLIIDLVNENPELKIRELAGLTKSSLST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.5
3 0.4
4 0.33
5 0.25
6 0.17
7 0.17
8 0.16
9 0.13
10 0.1
11 0.09
12 0.09
13 0.09
14 0.1
15 0.09
16 0.1
17 0.09
18 0.09
19 0.09
20 0.09
21 0.08
22 0.07
23 0.07
24 0.05
25 0.05
26 0.05
27 0.05
28 0.06
29 0.07
30 0.07
31 0.09
32 0.1
33 0.11
34 0.14
35 0.14
36 0.15
37 0.17
38 0.24
39 0.24
40 0.28
41 0.27
42 0.26
43 0.27
44 0.26
45 0.28
46 0.28
47 0.3
48 0.33
49 0.38
50 0.41
51 0.49
52 0.59
53 0.59
54 0.55
55 0.53
56 0.54
57 0.51
58 0.47
59 0.42
60 0.32
61 0.28
62 0.27
63 0.24
64 0.17
65 0.16
66 0.15
67 0.13
68 0.12
69 0.11
70 0.1
71 0.11
72 0.12
73 0.12
74 0.13
75 0.11
76 0.12
77 0.12
78 0.11
79 0.11
80 0.09
81 0.08
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.07
88 0.1
89 0.12
90 0.13
91 0.16
92 0.19
93 0.22
94 0.29
95 0.33
96 0.36
97 0.4
98 0.43
99 0.46
100 0.47
101 0.49
102 0.47
103 0.51
104 0.46
105 0.47
106 0.52
107 0.54
108 0.62
109 0.68
110 0.74
111 0.73
112 0.79
113 0.77
114 0.76
115 0.68
116 0.59
117 0.54
118 0.46
119 0.41
120 0.35
121 0.31
122 0.22
123 0.22
124 0.2
125 0.14
126 0.1
127 0.08
128 0.05
129 0.05
130 0.06
131 0.06
132 0.06
133 0.05
134 0.06
135 0.06
136 0.06
137 0.05
138 0.05
139 0.04
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.04
146 0.05
147 0.06
148 0.07
149 0.09
150 0.1
151 0.11
152 0.12
153 0.15
154 0.18
155 0.21
156 0.21
157 0.21
158 0.21
159 0.22
160 0.25
161 0.3
162 0.31
163 0.31
164 0.37
165 0.45
166 0.53
167 0.61
168 0.68
169 0.67
170 0.73
171 0.77
172 0.79
173 0.77
174 0.7
175 0.64
176 0.55
177 0.49
178 0.41
179 0.34
180 0.24
181 0.17
182 0.15
183 0.11
184 0.09
185 0.07
186 0.06
187 0.07
188 0.08
189 0.08
190 0.11
191 0.12
192 0.16
193 0.16
194 0.16
195 0.16
196 0.15
197 0.14
198 0.11
199 0.11
200 0.07
201 0.06
202 0.06
203 0.05
204 0.06
205 0.07
206 0.1
207 0.11
208 0.16
209 0.18
210 0.26
211 0.35
212 0.43
213 0.48
214 0.51
215 0.57
216 0.56
217 0.57
218 0.54
219 0.5
220 0.47
221 0.47
222 0.49
223 0.49
224 0.55
225 0.6
226 0.64
227 0.68
228 0.69
229 0.71
230 0.73
231 0.74
232 0.75
233 0.78
234 0.8
235 0.8
236 0.77
237 0.74
238 0.72
239 0.69
240 0.68
241 0.65
242 0.6
243 0.54
244 0.52
245 0.47
246 0.41
247 0.36
248 0.27
249 0.2
250 0.15
251 0.13
252 0.11
253 0.11
254 0.15
255 0.16
256 0.16
257 0.19
258 0.18
259 0.22
260 0.22
261 0.25
262 0.25
263 0.24
264 0.24