Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PBG2

Protein Details
Accession A0A137PBG2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-45EYKFCNKCKLEIKDNKKFCKNCQPKVNKTKKYYSYKFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MKQLIKLMEYKFCNKCKLEIKDNKKFCKNCQPKVNKTKKYYSYKFRNSQLVRIGQDINSTSTTSKKPSSPESRIIPAKLKIIYYTNPLDINLMSQVQYSKFTNFQSLNYLSESNSITDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.57
4 0.6
5 0.63
6 0.66
7 0.71
8 0.74
9 0.81
10 0.82
11 0.81
12 0.77
13 0.73
14 0.74
15 0.74
16 0.73
17 0.75
18 0.76
19 0.78
20 0.85
21 0.89
22 0.86
23 0.83
24 0.83
25 0.82
26 0.82
27 0.79
28 0.78
29 0.78
30 0.78
31 0.79
32 0.74
33 0.74
34 0.65
35 0.63
36 0.59
37 0.53
38 0.45
39 0.4
40 0.36
41 0.26
42 0.26
43 0.21
44 0.17
45 0.13
46 0.12
47 0.11
48 0.13
49 0.14
50 0.15
51 0.17
52 0.17
53 0.19
54 0.28
55 0.36
56 0.38
57 0.43
58 0.44
59 0.48
60 0.49
61 0.48
62 0.44
63 0.37
64 0.36
65 0.31
66 0.27
67 0.23
68 0.23
69 0.23
70 0.23
71 0.23
72 0.22
73 0.21
74 0.21
75 0.2
76 0.17
77 0.16
78 0.13
79 0.11
80 0.1
81 0.1
82 0.11
83 0.11
84 0.15
85 0.15
86 0.17
87 0.2
88 0.21
89 0.27
90 0.27
91 0.27
92 0.31
93 0.31
94 0.3
95 0.3
96 0.29
97 0.22
98 0.25
99 0.24