Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137NQ26

Protein Details
Accession A0A137NQ26    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
292-316ANGERVKYNKKIKSRGNYKKFTNEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041426  Mos1_HTH  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF13412  HTH_24  
PF17906  HTH_48  
Amino Acid Sequences MDSENKIINKYLYKLYEQGKNETEAYEEFSKTHSLHSISLKTVSIWFIKFRLGENSLVDKNLSNKSKLTDDFLISLINENPELNMAELAVLAGTTRQAISKRLNQINSGEQRVSYIKKSSMNASKKLTDEYLIKLIKENPGHNMTELANLAGVSQPAVSVRLKKINSSRSHDNKIVLERNARKAQRKTYVKIKDEDLINLINENPELNMSEIATLANVSTICISKRLRKINADSEIVNYHKKTSAQGPRKKFTDEYLIKLINDNPEMNMSELAALANCSATSISNRLSKINANGERVKYNKKIKSRGNYKKFTNEFLINSISENPELNIYELAKLVGASQSTILRRIKYINKDGERAIMSAKDIKNIQKSCQKKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.49
4 0.48
5 0.5
6 0.46
7 0.46
8 0.43
9 0.37
10 0.34
11 0.27
12 0.29
13 0.26
14 0.24
15 0.2
16 0.21
17 0.24
18 0.22
19 0.24
20 0.23
21 0.22
22 0.26
23 0.32
24 0.34
25 0.33
26 0.35
27 0.32
28 0.28
29 0.28
30 0.26
31 0.23
32 0.21
33 0.21
34 0.2
35 0.23
36 0.23
37 0.24
38 0.28
39 0.27
40 0.28
41 0.29
42 0.35
43 0.32
44 0.32
45 0.3
46 0.25
47 0.27
48 0.33
49 0.32
50 0.28
51 0.28
52 0.31
53 0.37
54 0.36
55 0.38
56 0.33
57 0.32
58 0.31
59 0.29
60 0.27
61 0.21
62 0.21
63 0.16
64 0.14
65 0.12
66 0.1
67 0.1
68 0.1
69 0.11
70 0.09
71 0.08
72 0.07
73 0.06
74 0.06
75 0.06
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.07
84 0.08
85 0.13
86 0.19
87 0.26
88 0.36
89 0.41
90 0.43
91 0.43
92 0.45
93 0.49
94 0.48
95 0.44
96 0.35
97 0.29
98 0.3
99 0.31
100 0.3
101 0.24
102 0.23
103 0.23
104 0.27
105 0.29
106 0.34
107 0.4
108 0.43
109 0.46
110 0.47
111 0.47
112 0.43
113 0.44
114 0.37
115 0.3
116 0.27
117 0.24
118 0.27
119 0.24
120 0.23
121 0.23
122 0.25
123 0.28
124 0.29
125 0.27
126 0.24
127 0.27
128 0.27
129 0.25
130 0.25
131 0.2
132 0.19
133 0.18
134 0.13
135 0.09
136 0.09
137 0.09
138 0.07
139 0.06
140 0.04
141 0.04
142 0.04
143 0.04
144 0.07
145 0.07
146 0.1
147 0.13
148 0.2
149 0.2
150 0.25
151 0.31
152 0.37
153 0.43
154 0.46
155 0.53
156 0.53
157 0.58
158 0.56
159 0.52
160 0.46
161 0.46
162 0.44
163 0.36
164 0.36
165 0.35
166 0.39
167 0.44
168 0.45
169 0.47
170 0.47
171 0.52
172 0.55
173 0.57
174 0.54
175 0.58
176 0.63
177 0.59
178 0.56
179 0.51
180 0.45
181 0.4
182 0.36
183 0.28
184 0.19
185 0.16
186 0.14
187 0.12
188 0.08
189 0.07
190 0.06
191 0.05
192 0.04
193 0.05
194 0.05
195 0.05
196 0.05
197 0.06
198 0.06
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.04
205 0.04
206 0.05
207 0.06
208 0.06
209 0.11
210 0.13
211 0.2
212 0.28
213 0.35
214 0.39
215 0.44
216 0.5
217 0.54
218 0.57
219 0.52
220 0.45
221 0.39
222 0.38
223 0.33
224 0.3
225 0.22
226 0.19
227 0.19
228 0.19
229 0.19
230 0.26
231 0.35
232 0.42
233 0.5
234 0.56
235 0.6
236 0.62
237 0.63
238 0.55
239 0.48
240 0.48
241 0.43
242 0.4
243 0.4
244 0.39
245 0.35
246 0.36
247 0.35
248 0.27
249 0.27
250 0.22
251 0.16
252 0.17
253 0.18
254 0.17
255 0.15
256 0.11
257 0.09
258 0.09
259 0.08
260 0.06
261 0.06
262 0.05
263 0.05
264 0.04
265 0.04
266 0.05
267 0.05
268 0.08
269 0.1
270 0.14
271 0.18
272 0.2
273 0.21
274 0.23
275 0.25
276 0.29
277 0.36
278 0.37
279 0.39
280 0.43
281 0.45
282 0.48
283 0.49
284 0.51
285 0.49
286 0.54
287 0.56
288 0.6
289 0.67
290 0.7
291 0.77
292 0.81
293 0.84
294 0.84
295 0.85
296 0.82
297 0.83
298 0.76
299 0.7
300 0.66
301 0.59
302 0.51
303 0.46
304 0.43
305 0.32
306 0.31
307 0.28
308 0.23
309 0.19
310 0.18
311 0.15
312 0.15
313 0.15
314 0.15
315 0.15
316 0.14
317 0.14
318 0.14
319 0.14
320 0.11
321 0.1
322 0.1
323 0.1
324 0.09
325 0.09
326 0.11
327 0.16
328 0.17
329 0.24
330 0.26
331 0.26
332 0.28
333 0.35
334 0.42
335 0.46
336 0.54
337 0.58
338 0.6
339 0.63
340 0.62
341 0.61
342 0.54
343 0.45
344 0.38
345 0.29
346 0.27
347 0.31
348 0.31
349 0.3
350 0.32
351 0.38
352 0.45
353 0.47
354 0.52
355 0.53