Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PFR6

Protein Details
Accession A0A137PFR6    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
248-283STPPRRTQRSATQTRRNRAKRPSKPKLSAKERVRLIHydrophilic
NLS Segment(s)
PositionSequence
261-279TRRNRAKRPSKPKLSAKER
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR038718  SNF2-like_sf  
Amino Acid Sequences MVRRSARLQQKAEEKKLQDTQNAELEVLTPPDSNVKITTESKPVQNTTTPSRNLKKTGSSAKVKALNSESSSSITPKEEDLTVEVLSSDTELVNFEYDSDFATTPSRVLRSASSNAKEIASNSEPSSSITSKKRNLTVSAPSSDPELSSLTDDSDFTPTSSPAAYKKSKVYKPTIKETVSHPSQAKKSLNTRNPAKKGKSSRSVVSIAENSDSEYEYESPIEEPQDSIDSDENLFDQLASPENSLTPSTPPRRTQRSATQTRRNRAKRPSKPKLSAKERVRLIHPELDEIWTNLANEPVIPTESIEQPADLKLPLLPFQKEGINWMIKQEKTFFGGGILADEMGMGRQFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.67
3 0.7
4 0.67
5 0.62
6 0.56
7 0.52
8 0.5
9 0.48
10 0.4
11 0.32
12 0.28
13 0.23
14 0.21
15 0.18
16 0.11
17 0.11
18 0.16
19 0.17
20 0.17
21 0.17
22 0.18
23 0.22
24 0.26
25 0.3
26 0.33
27 0.35
28 0.38
29 0.42
30 0.41
31 0.4
32 0.41
33 0.42
34 0.42
35 0.47
36 0.47
37 0.51
38 0.57
39 0.59
40 0.59
41 0.58
42 0.57
43 0.56
44 0.61
45 0.61
46 0.6
47 0.58
48 0.61
49 0.63
50 0.57
51 0.54
52 0.48
53 0.45
54 0.4
55 0.39
56 0.33
57 0.28
58 0.29
59 0.25
60 0.23
61 0.2
62 0.18
63 0.16
64 0.17
65 0.15
66 0.15
67 0.16
68 0.16
69 0.14
70 0.13
71 0.12
72 0.1
73 0.09
74 0.09
75 0.07
76 0.05
77 0.05
78 0.06
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.08
86 0.1
87 0.09
88 0.09
89 0.11
90 0.11
91 0.11
92 0.13
93 0.13
94 0.12
95 0.13
96 0.15
97 0.18
98 0.24
99 0.31
100 0.3
101 0.31
102 0.31
103 0.3
104 0.28
105 0.24
106 0.25
107 0.2
108 0.19
109 0.18
110 0.18
111 0.18
112 0.19
113 0.22
114 0.17
115 0.21
116 0.25
117 0.32
118 0.36
119 0.4
120 0.44
121 0.42
122 0.44
123 0.43
124 0.44
125 0.42
126 0.38
127 0.34
128 0.29
129 0.28
130 0.25
131 0.21
132 0.14
133 0.11
134 0.09
135 0.1
136 0.1
137 0.08
138 0.09
139 0.09
140 0.09
141 0.1
142 0.1
143 0.09
144 0.1
145 0.09
146 0.09
147 0.09
148 0.09
149 0.1
150 0.16
151 0.18
152 0.19
153 0.26
154 0.34
155 0.38
156 0.43
157 0.49
158 0.51
159 0.54
160 0.59
161 0.59
162 0.51
163 0.49
164 0.46
165 0.45
166 0.39
167 0.37
168 0.31
169 0.29
170 0.3
171 0.35
172 0.34
173 0.3
174 0.38
175 0.43
176 0.48
177 0.51
178 0.58
179 0.6
180 0.66
181 0.69
182 0.65
183 0.63
184 0.66
185 0.67
186 0.66
187 0.61
188 0.56
189 0.52
190 0.51
191 0.43
192 0.38
193 0.31
194 0.23
195 0.21
196 0.18
197 0.14
198 0.13
199 0.12
200 0.09
201 0.09
202 0.09
203 0.09
204 0.09
205 0.08
206 0.09
207 0.09
208 0.1
209 0.08
210 0.07
211 0.08
212 0.1
213 0.09
214 0.1
215 0.1
216 0.1
217 0.1
218 0.11
219 0.1
220 0.08
221 0.08
222 0.06
223 0.06
224 0.06
225 0.08
226 0.09
227 0.09
228 0.09
229 0.1
230 0.11
231 0.11
232 0.11
233 0.13
234 0.2
235 0.27
236 0.32
237 0.39
238 0.46
239 0.54
240 0.57
241 0.61
242 0.63
243 0.67
244 0.72
245 0.75
246 0.77
247 0.77
248 0.83
249 0.86
250 0.84
251 0.81
252 0.81
253 0.83
254 0.83
255 0.86
256 0.87
257 0.87
258 0.89
259 0.9
260 0.9
261 0.88
262 0.87
263 0.83
264 0.81
265 0.76
266 0.7
267 0.65
268 0.6
269 0.56
270 0.52
271 0.45
272 0.4
273 0.35
274 0.34
275 0.31
276 0.25
277 0.22
278 0.16
279 0.17
280 0.14
281 0.14
282 0.11
283 0.1
284 0.11
285 0.11
286 0.11
287 0.1
288 0.11
289 0.13
290 0.15
291 0.18
292 0.17
293 0.16
294 0.16
295 0.17
296 0.17
297 0.14
298 0.12
299 0.12
300 0.14
301 0.19
302 0.23
303 0.23
304 0.24
305 0.26
306 0.29
307 0.27
308 0.29
309 0.3
310 0.3
311 0.29
312 0.34
313 0.39
314 0.36
315 0.39
316 0.39
317 0.35
318 0.33
319 0.34
320 0.27
321 0.22
322 0.22
323 0.19
324 0.17
325 0.15
326 0.11
327 0.1
328 0.09
329 0.08
330 0.07