Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P0N3

Protein Details
Accession A0A137P0N3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-56FFAYRNYKKYEKKRTARSTENTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 5, pero 3, E.R. 3, golg 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYLQRRSYESFQSKRIIVFSTVPAVLFVGFVIVIFFAYRNYKKYEKKRTARSTENTGHELSVYNQTSANRDHGERRQDRTENNGLSDEFCDPLPLYTPPGNSVQTQALQHVEDHRVKSPPYSVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.37
4 0.3
5 0.28
6 0.25
7 0.24
8 0.23
9 0.21
10 0.19
11 0.17
12 0.14
13 0.11
14 0.08
15 0.05
16 0.04
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.04
23 0.05
24 0.11
25 0.13
26 0.15
27 0.21
28 0.29
29 0.38
30 0.48
31 0.58
32 0.63
33 0.71
34 0.79
35 0.84
36 0.83
37 0.83
38 0.77
39 0.74
40 0.7
41 0.64
42 0.56
43 0.46
44 0.38
45 0.3
46 0.26
47 0.19
48 0.19
49 0.16
50 0.14
51 0.15
52 0.15
53 0.17
54 0.18
55 0.19
56 0.14
57 0.15
58 0.2
59 0.24
60 0.33
61 0.35
62 0.4
63 0.44
64 0.45
65 0.45
66 0.48
67 0.5
68 0.41
69 0.39
70 0.35
71 0.28
72 0.26
73 0.26
74 0.2
75 0.13
76 0.11
77 0.11
78 0.1
79 0.1
80 0.11
81 0.11
82 0.14
83 0.16
84 0.17
85 0.18
86 0.22
87 0.23
88 0.21
89 0.23
90 0.22
91 0.23
92 0.23
93 0.23
94 0.21
95 0.2
96 0.21
97 0.22
98 0.26
99 0.28
100 0.3
101 0.32
102 0.34
103 0.34
104 0.36