Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JAD6

Protein Details
Accession G3JAD6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
285-308FISFVRGKRRSDRRDESHKATYNEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, cyto 2, pero 1, E.R. 1, vacu 1, cyto_mito 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG cmt:CCM_03376  -  
Amino Acid Sequences MLLRPLALAAIAAAFIIVPEMSENDENIFKALPIQSHGSAFPFGTPKSAFDQSISVPCRGCRGRHTQLRLDFTIEDEKKLLLNGFELYPETDPWGADLQATVVNGHRRPRSKKLGYSLAVYPKAIAEEDKMELIEVDLKIIEVGTRFVDGVPTVKVELIKTPGGNLAMSTVAFDHPVESPCDTIWCRAKELADKLWVQAHRIKNCGKAAVPEPGSEAEPMPPSYSDLHDAGDIKVTEPTITSKKEWRHLMKSVLGHIIMPIFMGVTAGVAIAFLALCIQSIAGRFISFVRGKRRSDRRDESHKATYNEQATSEEKVQLMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.04
5 0.03
6 0.04
7 0.06
8 0.09
9 0.1
10 0.11
11 0.13
12 0.14
13 0.15
14 0.15
15 0.14
16 0.11
17 0.14
18 0.16
19 0.15
20 0.17
21 0.21
22 0.22
23 0.23
24 0.24
25 0.22
26 0.21
27 0.2
28 0.2
29 0.19
30 0.17
31 0.2
32 0.2
33 0.2
34 0.25
35 0.28
36 0.25
37 0.23
38 0.26
39 0.24
40 0.32
41 0.32
42 0.28
43 0.26
44 0.26
45 0.33
46 0.33
47 0.34
48 0.32
49 0.39
50 0.47
51 0.55
52 0.61
53 0.61
54 0.65
55 0.69
56 0.63
57 0.56
58 0.46
59 0.4
60 0.44
61 0.36
62 0.3
63 0.24
64 0.23
65 0.21
66 0.21
67 0.19
68 0.1
69 0.1
70 0.11
71 0.1
72 0.1
73 0.11
74 0.11
75 0.11
76 0.11
77 0.12
78 0.11
79 0.1
80 0.11
81 0.12
82 0.11
83 0.1
84 0.09
85 0.08
86 0.09
87 0.09
88 0.08
89 0.1
90 0.14
91 0.17
92 0.23
93 0.28
94 0.34
95 0.4
96 0.49
97 0.57
98 0.59
99 0.63
100 0.65
101 0.68
102 0.62
103 0.59
104 0.54
105 0.5
106 0.44
107 0.37
108 0.3
109 0.22
110 0.21
111 0.17
112 0.13
113 0.08
114 0.09
115 0.09
116 0.09
117 0.09
118 0.08
119 0.08
120 0.08
121 0.09
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.04
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.06
137 0.07
138 0.06
139 0.06
140 0.06
141 0.07
142 0.07
143 0.07
144 0.09
145 0.1
146 0.11
147 0.1
148 0.11
149 0.11
150 0.11
151 0.11
152 0.09
153 0.07
154 0.06
155 0.06
156 0.06
157 0.05
158 0.05
159 0.05
160 0.05
161 0.06
162 0.07
163 0.08
164 0.09
165 0.09
166 0.09
167 0.09
168 0.12
169 0.12
170 0.15
171 0.2
172 0.2
173 0.21
174 0.22
175 0.24
176 0.27
177 0.3
178 0.29
179 0.27
180 0.26
181 0.25
182 0.29
183 0.28
184 0.25
185 0.28
186 0.32
187 0.3
188 0.34
189 0.36
190 0.37
191 0.38
192 0.38
193 0.32
194 0.29
195 0.28
196 0.31
197 0.3
198 0.24
199 0.24
200 0.22
201 0.23
202 0.2
203 0.17
204 0.12
205 0.13
206 0.13
207 0.12
208 0.12
209 0.13
210 0.14
211 0.15
212 0.16
213 0.15
214 0.15
215 0.15
216 0.16
217 0.15
218 0.17
219 0.15
220 0.13
221 0.13
222 0.13
223 0.11
224 0.11
225 0.15
226 0.16
227 0.19
228 0.22
229 0.28
230 0.33
231 0.41
232 0.49
233 0.53
234 0.54
235 0.57
236 0.6
237 0.58
238 0.55
239 0.51
240 0.44
241 0.37
242 0.3
243 0.25
244 0.2
245 0.14
246 0.11
247 0.08
248 0.05
249 0.04
250 0.05
251 0.04
252 0.03
253 0.03
254 0.03
255 0.03
256 0.03
257 0.03
258 0.03
259 0.03
260 0.02
261 0.03
262 0.03
263 0.03
264 0.03
265 0.04
266 0.05
267 0.06
268 0.09
269 0.09
270 0.09
271 0.1
272 0.11
273 0.19
274 0.22
275 0.27
276 0.35
277 0.42
278 0.47
279 0.56
280 0.67
281 0.68
282 0.74
283 0.79
284 0.78
285 0.82
286 0.85
287 0.83
288 0.82
289 0.8
290 0.73
291 0.67
292 0.65
293 0.59
294 0.52
295 0.45
296 0.39
297 0.34
298 0.36
299 0.34
300 0.29