Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P300

Protein Details
Accession A0A137P300   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTLKRRNNGRNKKGRGHVKPVRCTNCHydrophilic
84-110VRVRSREGRRIRTPPPRFRFKDGKKVABasic
NLS Segment(s)
PositionSequence
5-17RRNNGRNKKGRGH
87-109RSREGRRIRTPPPRFRFKDGKKV
Subcellular Location(s) mito 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTLKRRNNGRNKKGRGHVKPVRCTNCARCVPKDKAIKRFTIRNMIEAAAVRDLADASVYTDYVVPKLYVKLQYCVSCAIHAHIVRVRSREGRRIRTPPPRFRFKDGKKVAPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.85
3 0.84
4 0.82
5 0.81
6 0.82
7 0.83
8 0.79
9 0.72
10 0.7
11 0.66
12 0.67
13 0.66
14 0.61
15 0.58
16 0.6
17 0.63
18 0.65
19 0.68
20 0.65
21 0.66
22 0.64
23 0.65
24 0.61
25 0.62
26 0.58
27 0.58
28 0.52
29 0.44
30 0.42
31 0.35
32 0.32
33 0.25
34 0.22
35 0.11
36 0.11
37 0.09
38 0.07
39 0.06
40 0.05
41 0.05
42 0.03
43 0.04
44 0.04
45 0.04
46 0.04
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.07
53 0.08
54 0.11
55 0.16
56 0.18
57 0.2
58 0.23
59 0.24
60 0.25
61 0.27
62 0.24
63 0.19
64 0.18
65 0.17
66 0.19
67 0.18
68 0.2
69 0.2
70 0.22
71 0.24
72 0.26
73 0.28
74 0.31
75 0.35
76 0.41
77 0.48
78 0.54
79 0.6
80 0.65
81 0.71
82 0.73
83 0.79
84 0.81
85 0.81
86 0.82
87 0.79
88 0.8
89 0.82
90 0.79
91 0.8
92 0.78
93 0.79