Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PCH2

Protein Details
Accession A0A137PCH2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-74YPPPARKDPKRGLPTKQPIPHydrophilic
NLS Segment(s)
PositionSequence
57-69PPARKDPKRGLPT
Subcellular Location(s) mito 21.5, cyto_mito 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019591  Mrp/NBP35_ATP-bd  
IPR044304  NUBPL-like  
IPR027417  P-loop_NTPase  
IPR033756  YlxH/NBP35  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140663  F:ATP-dependent FeS chaperone activity  
GO:0016787  F:hydrolase activity  
GO:0051536  F:iron-sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF10609  ParA  
CDD cd02037  Mrp_NBP35  
Amino Acid Sequences MTLNLIKNSSKLIIRNSCKIRSSLGLSRLLSTNTQLLHENPLGLPKRGPGGFGSYPPPARKDPKRGLPTKQPIPKVKHVICVASGKGGVGKSTTSINLAIALNRKKLKVGVLDADLFGPSIPKLLNLNGEPELNEKGHLLPLKNYGLASMSMGFLVPEGAPIVWRGLMVMKALQQLIYEVDWEGGLDVLVVDMPPGTGDVQLTLSQLVPISGSVIVTTPQDLALIDARKGVEMFKKVNIPVSHKTNQTPINSNNSKLLGIVQNMNLYTCPHCNKSSHVFGSNGGNRMAKEFDIDLLGDIPLDPKIMELSDSGTPITVMEPESKISLAYSEIADKVIEKLNLKQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.56
3 0.6
4 0.63
5 0.61
6 0.59
7 0.53
8 0.49
9 0.5
10 0.48
11 0.47
12 0.48
13 0.46
14 0.47
15 0.45
16 0.41
17 0.34
18 0.29
19 0.27
20 0.2
21 0.21
22 0.2
23 0.2
24 0.24
25 0.24
26 0.23
27 0.19
28 0.27
29 0.28
30 0.28
31 0.27
32 0.23
33 0.29
34 0.27
35 0.28
36 0.21
37 0.26
38 0.27
39 0.29
40 0.31
41 0.3
42 0.34
43 0.35
44 0.38
45 0.36
46 0.43
47 0.49
48 0.56
49 0.6
50 0.66
51 0.74
52 0.76
53 0.77
54 0.79
55 0.8
56 0.8
57 0.78
58 0.76
59 0.74
60 0.76
61 0.77
62 0.76
63 0.69
64 0.67
65 0.61
66 0.54
67 0.49
68 0.45
69 0.36
70 0.28
71 0.25
72 0.18
73 0.18
74 0.16
75 0.14
76 0.1
77 0.1
78 0.09
79 0.11
80 0.11
81 0.1
82 0.1
83 0.1
84 0.12
85 0.12
86 0.13
87 0.19
88 0.21
89 0.26
90 0.27
91 0.28
92 0.26
93 0.27
94 0.29
95 0.27
96 0.28
97 0.26
98 0.26
99 0.27
100 0.26
101 0.25
102 0.2
103 0.15
104 0.11
105 0.08
106 0.05
107 0.06
108 0.05
109 0.06
110 0.08
111 0.09
112 0.13
113 0.13
114 0.16
115 0.16
116 0.16
117 0.15
118 0.16
119 0.17
120 0.13
121 0.13
122 0.11
123 0.1
124 0.13
125 0.15
126 0.14
127 0.13
128 0.18
129 0.18
130 0.18
131 0.18
132 0.15
133 0.14
134 0.13
135 0.12
136 0.08
137 0.07
138 0.06
139 0.06
140 0.06
141 0.05
142 0.05
143 0.04
144 0.03
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.06
156 0.06
157 0.07
158 0.08
159 0.09
160 0.08
161 0.08
162 0.08
163 0.08
164 0.07
165 0.06
166 0.05
167 0.05
168 0.05
169 0.05
170 0.04
171 0.03
172 0.03
173 0.03
174 0.02
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.03
183 0.03
184 0.04
185 0.04
186 0.05
187 0.06
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.06
195 0.05
196 0.04
197 0.05
198 0.05
199 0.05
200 0.04
201 0.05
202 0.06
203 0.06
204 0.06
205 0.05
206 0.05
207 0.06
208 0.05
209 0.06
210 0.1
211 0.11
212 0.11
213 0.12
214 0.12
215 0.12
216 0.13
217 0.14
218 0.14
219 0.17
220 0.19
221 0.2
222 0.24
223 0.24
224 0.31
225 0.32
226 0.33
227 0.36
228 0.41
229 0.43
230 0.42
231 0.44
232 0.43
233 0.46
234 0.44
235 0.44
236 0.4
237 0.46
238 0.45
239 0.45
240 0.42
241 0.37
242 0.33
243 0.27
244 0.26
245 0.19
246 0.19
247 0.2
248 0.18
249 0.19
250 0.19
251 0.19
252 0.16
253 0.15
254 0.15
255 0.18
256 0.21
257 0.23
258 0.26
259 0.27
260 0.33
261 0.38
262 0.44
263 0.43
264 0.43
265 0.4
266 0.39
267 0.47
268 0.46
269 0.41
270 0.34
271 0.31
272 0.28
273 0.29
274 0.29
275 0.19
276 0.17
277 0.15
278 0.14
279 0.14
280 0.14
281 0.12
282 0.11
283 0.11
284 0.08
285 0.08
286 0.08
287 0.07
288 0.07
289 0.06
290 0.06
291 0.07
292 0.08
293 0.08
294 0.08
295 0.11
296 0.13
297 0.14
298 0.13
299 0.12
300 0.12
301 0.11
302 0.12
303 0.1
304 0.09
305 0.12
306 0.13
307 0.15
308 0.16
309 0.16
310 0.15
311 0.14
312 0.14
313 0.12
314 0.12
315 0.12
316 0.13
317 0.14
318 0.14
319 0.14
320 0.14
321 0.15
322 0.19
323 0.22
324 0.21