Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PBF0

Protein Details
Accession A0A137PBF0   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-29KVQQNCVECKRRKIKCSRAQPCSNCLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MRPKVQQNCVECKRRKIKCSRAQPCSNCLKSGVFCFYINKKQISIEADESRSKTQDLTRYQVLRNLKLEEKWLKLVFKVEMVINWCSEDPRLVHLVVSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.8
4 0.82
5 0.82
6 0.88
7 0.87
8 0.86
9 0.88
10 0.82
11 0.78
12 0.77
13 0.69
14 0.59
15 0.51
16 0.43
17 0.35
18 0.34
19 0.31
20 0.22
21 0.21
22 0.24
23 0.27
24 0.32
25 0.33
26 0.31
27 0.28
28 0.26
29 0.29
30 0.27
31 0.26
32 0.23
33 0.22
34 0.23
35 0.24
36 0.25
37 0.23
38 0.21
39 0.18
40 0.15
41 0.16
42 0.21
43 0.23
44 0.26
45 0.31
46 0.33
47 0.33
48 0.37
49 0.37
50 0.34
51 0.33
52 0.32
53 0.29
54 0.27
55 0.33
56 0.33
57 0.33
58 0.34
59 0.34
60 0.32
61 0.3
62 0.33
63 0.27
64 0.24
65 0.22
66 0.17
67 0.17
68 0.2
69 0.2
70 0.17
71 0.18
72 0.17
73 0.16
74 0.16
75 0.17
76 0.14
77 0.17
78 0.2
79 0.18