Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137NPU0

Protein Details
Accession A0A137NPU0   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
77-96FRYEHPLVKKTNKKKRPMLIHydrophilic
NLS Segment(s)
PositionSequence
89-92KKKR
Subcellular Location(s) mito 12.5mito_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000407  GDA1_CD39_NTPase  
Gene Ontology GO:0017110  F:nucleoside diphosphate phosphatase activity  
Pfam View protein in Pfam  
PF01150  GDA1_CD39  
Amino Acid Sequences KYNKKKFQRDKDFYYYCFNMAYYINLLTHGYHVAPDRKIVFTETVEETDISWTLGAMIYEVHLLYPSGQCCDDWNDFRYEHPLVKKTNKKKRPMLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.61
3 0.5
4 0.43
5 0.34
6 0.25
7 0.21
8 0.2
9 0.13
10 0.13
11 0.12
12 0.12
13 0.13
14 0.11
15 0.11
16 0.1
17 0.08
18 0.09
19 0.12
20 0.15
21 0.15
22 0.18
23 0.19
24 0.18
25 0.19
26 0.19
27 0.17
28 0.14
29 0.16
30 0.15
31 0.14
32 0.14
33 0.13
34 0.12
35 0.11
36 0.1
37 0.07
38 0.06
39 0.05
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.08
53 0.09
54 0.1
55 0.11
56 0.11
57 0.13
58 0.18
59 0.22
60 0.23
61 0.25
62 0.27
63 0.27
64 0.28
65 0.31
66 0.28
67 0.29
68 0.32
69 0.35
70 0.39
71 0.49
72 0.58
73 0.64
74 0.73
75 0.76
76 0.79