Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PIV2

Protein Details
Accession A0A137PIV2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33DQEKSLKNTKPYKINRRTIFKPKSKENQIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR002775  DNA/RNA-bd_Alba-like  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01918  Alba  
Amino Acid Sequences MKIDQEKSLKNTKPYKINRRTIFKPKSKENQIYITTKTPLNSYRLRALKLLEKFDQVDFIALGKATIKLCQLFCAIESTISDSWSIEWTSGQTKVIDDMIPEDEVNFKNSLMIDFINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.78
4 0.83
5 0.83
6 0.82
7 0.83
8 0.84
9 0.83
10 0.81
11 0.79
12 0.78
13 0.79
14 0.8
15 0.8
16 0.73
17 0.71
18 0.67
19 0.63
20 0.57
21 0.5
22 0.42
23 0.36
24 0.32
25 0.27
26 0.25
27 0.26
28 0.27
29 0.26
30 0.32
31 0.34
32 0.35
33 0.33
34 0.32
35 0.34
36 0.34
37 0.35
38 0.28
39 0.27
40 0.26
41 0.25
42 0.24
43 0.17
44 0.14
45 0.1
46 0.09
47 0.07
48 0.06
49 0.06
50 0.05
51 0.06
52 0.06
53 0.07
54 0.08
55 0.1
56 0.11
57 0.12
58 0.13
59 0.11
60 0.11
61 0.13
62 0.12
63 0.1
64 0.11
65 0.14
66 0.13
67 0.13
68 0.13
69 0.1
70 0.11
71 0.12
72 0.12
73 0.08
74 0.08
75 0.09
76 0.12
77 0.13
78 0.14
79 0.12
80 0.12
81 0.14
82 0.15
83 0.14
84 0.12
85 0.13
86 0.14
87 0.14
88 0.13
89 0.12
90 0.15
91 0.15
92 0.18
93 0.16
94 0.14
95 0.15
96 0.15
97 0.16
98 0.14