Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P3C6

Protein Details
Accession A0A137P3C6    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-80VGKPDKIKEDKKQAKLNKLKFBasic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 10, nucl 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR040807  DUF5522  
Pfam View protein in Pfam  
PF17653  DUF5522  
Amino Acid Sequences MSTKEEPKWKAVHDEKVKNGELHYEDPDTGYFVFTELSHKKRGYCCGSQCRHCPFDFENVGKPDKIKEDKKQAKLNKLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.65
4 0.65
5 0.55
6 0.48
7 0.43
8 0.36
9 0.32
10 0.29
11 0.24
12 0.21
13 0.21
14 0.21
15 0.17
16 0.13
17 0.11
18 0.08
19 0.07
20 0.07
21 0.06
22 0.12
23 0.15
24 0.17
25 0.21
26 0.22
27 0.25
28 0.27
29 0.34
30 0.34
31 0.37
32 0.42
33 0.48
34 0.54
35 0.56
36 0.6
37 0.59
38 0.57
39 0.51
40 0.48
41 0.4
42 0.42
43 0.42
44 0.38
45 0.38
46 0.38
47 0.4
48 0.36
49 0.35
50 0.29
51 0.32
52 0.39
53 0.4
54 0.46
55 0.55
56 0.64
57 0.72
58 0.79
59 0.79
60 0.82