Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PEC2

Protein Details
Accession A0A137PEC2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
103-133VPKSHAKPYVRSKGRKFERARGRRASRGYKNBasic
NLS Segment(s)
PositionSequence
88-133KKNSREAVKHFGAAGVPKSHAKPYVRSKGRKFERARGRRASRGYKN
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MSRIHRPPVSISRVVKLSANSADKTVVIVGTITNDERLSEVPALKVCALRFTRTARARIVQAGGECLTFDQLALRAPTGANCLLLRGKKNSREAVKHFGAAGVPKSHAKPYVRSKGRKFERARGRRASRGYKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.34
4 0.31
5 0.31
6 0.32
7 0.28
8 0.27
9 0.27
10 0.24
11 0.23
12 0.19
13 0.12
14 0.08
15 0.07
16 0.06
17 0.07
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.09
24 0.1
25 0.11
26 0.12
27 0.12
28 0.13
29 0.13
30 0.15
31 0.15
32 0.16
33 0.13
34 0.18
35 0.19
36 0.2
37 0.22
38 0.25
39 0.34
40 0.35
41 0.38
42 0.33
43 0.34
44 0.33
45 0.31
46 0.28
47 0.21
48 0.17
49 0.16
50 0.13
51 0.11
52 0.1
53 0.08
54 0.07
55 0.05
56 0.05
57 0.04
58 0.04
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.09
66 0.09
67 0.09
68 0.08
69 0.1
70 0.13
71 0.15
72 0.18
73 0.22
74 0.28
75 0.33
76 0.4
77 0.46
78 0.49
79 0.54
80 0.57
81 0.58
82 0.54
83 0.48
84 0.42
85 0.36
86 0.3
87 0.25
88 0.23
89 0.16
90 0.16
91 0.18
92 0.2
93 0.22
94 0.27
95 0.28
96 0.33
97 0.42
98 0.51
99 0.58
100 0.65
101 0.7
102 0.74
103 0.8
104 0.82
105 0.79
106 0.78
107 0.8
108 0.8
109 0.82
110 0.82
111 0.8
112 0.8
113 0.82