Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PIM0

Protein Details
Accession A0A137PIM0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-34QSFGKRHTKTHTQCRRCGRHSFHNQKKTCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTQSFGKRHTKTHTQCRRCGRHSFHNQKKTCAACGYPAAKLRNYNWGVKAQRRKTTGTGRMSHLKEVYRRFRNGFQEGTVATKKVVKTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.74
4 0.71
5 0.77
6 0.81
7 0.83
8 0.77
9 0.78
10 0.74
11 0.74
12 0.78
13 0.81
14 0.81
15 0.81
16 0.78
17 0.72
18 0.72
19 0.62
20 0.54
21 0.45
22 0.36
23 0.28
24 0.32
25 0.3
26 0.26
27 0.29
28 0.28
29 0.27
30 0.29
31 0.27
32 0.31
33 0.31
34 0.3
35 0.27
36 0.32
37 0.35
38 0.4
39 0.49
40 0.46
41 0.5
42 0.51
43 0.53
44 0.52
45 0.58
46 0.59
47 0.56
48 0.53
49 0.51
50 0.57
51 0.55
52 0.51
53 0.45
54 0.4
55 0.39
56 0.45
57 0.5
58 0.48
59 0.52
60 0.53
61 0.57
62 0.61
63 0.6
64 0.54
65 0.45
66 0.42
67 0.38
68 0.39
69 0.34
70 0.27
71 0.23
72 0.25
73 0.24