Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P4A3

Protein Details
Accession A0A137P4A3   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
229-251EIEKLLKKKPKDRCSQCTNTFFNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 2, golg 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001611  Leu-rich_rpt  
IPR003591  Leu-rich_rpt_typical-subtyp  
IPR032675  LRR_dom_sf  
Pfam View protein in Pfam  
PF13855  LRR_8  
PROSITE View protein in PROSITE  
PS51450  LRR  
Amino Acid Sequences MNPRRPINNYELDQEQLNLSNSFSIFHSIPTRKNVHLNPKNSAKLKNLISQRIGHAIDNGQSEVNLSGLQLFEVPPQISELQYFVTFNGQGICSDIELNLSLNNLEVFPKELLSLKNLTVLNLSGNNITFLPSTIDNLVNLRVFSVDNNKLEYLPCSLLKLKKLQIFNASSNPFPALKQSMEATSNNSVVRETTTIHFNPKLCLEEHCLRVLNQLDIRSIANEMHLPAEIEKLLKKKPKDRCSQCTNTFFNSAVDILKLKVFPIRVSSMDVVGVTAGIGGIREYPFLYQFCSFFCKEEYIKINHRDFFTQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.29
3 0.23
4 0.22
5 0.18
6 0.16
7 0.17
8 0.16
9 0.17
10 0.16
11 0.17
12 0.15
13 0.17
14 0.26
15 0.28
16 0.32
17 0.39
18 0.43
19 0.42
20 0.5
21 0.54
22 0.57
23 0.61
24 0.62
25 0.63
26 0.67
27 0.71
28 0.67
29 0.65
30 0.58
31 0.57
32 0.57
33 0.56
34 0.55
35 0.53
36 0.52
37 0.5
38 0.47
39 0.46
40 0.43
41 0.36
42 0.31
43 0.26
44 0.26
45 0.25
46 0.23
47 0.16
48 0.15
49 0.15
50 0.13
51 0.11
52 0.08
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.1
61 0.1
62 0.09
63 0.12
64 0.13
65 0.12
66 0.12
67 0.12
68 0.11
69 0.11
70 0.11
71 0.09
72 0.11
73 0.11
74 0.1
75 0.11
76 0.1
77 0.09
78 0.11
79 0.11
80 0.09
81 0.09
82 0.09
83 0.08
84 0.08
85 0.08
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.08
95 0.08
96 0.08
97 0.09
98 0.11
99 0.11
100 0.14
101 0.15
102 0.13
103 0.18
104 0.18
105 0.18
106 0.16
107 0.16
108 0.14
109 0.13
110 0.14
111 0.09
112 0.09
113 0.09
114 0.09
115 0.09
116 0.08
117 0.07
118 0.09
119 0.08
120 0.09
121 0.1
122 0.1
123 0.1
124 0.1
125 0.11
126 0.1
127 0.09
128 0.08
129 0.07
130 0.07
131 0.08
132 0.14
133 0.16
134 0.16
135 0.18
136 0.18
137 0.18
138 0.18
139 0.18
140 0.14
141 0.12
142 0.12
143 0.12
144 0.15
145 0.17
146 0.19
147 0.23
148 0.25
149 0.28
150 0.3
151 0.3
152 0.33
153 0.35
154 0.34
155 0.37
156 0.33
157 0.28
158 0.27
159 0.27
160 0.2
161 0.17
162 0.17
163 0.13
164 0.12
165 0.13
166 0.13
167 0.14
168 0.16
169 0.16
170 0.17
171 0.17
172 0.18
173 0.17
174 0.17
175 0.15
176 0.13
177 0.14
178 0.11
179 0.11
180 0.1
181 0.15
182 0.16
183 0.19
184 0.22
185 0.21
186 0.22
187 0.23
188 0.23
189 0.19
190 0.21
191 0.24
192 0.27
193 0.28
194 0.28
195 0.27
196 0.25
197 0.29
198 0.29
199 0.25
200 0.22
201 0.21
202 0.19
203 0.19
204 0.2
205 0.16
206 0.15
207 0.11
208 0.1
209 0.1
210 0.1
211 0.09
212 0.09
213 0.09
214 0.09
215 0.1
216 0.09
217 0.1
218 0.12
219 0.15
220 0.22
221 0.28
222 0.34
223 0.42
224 0.52
225 0.61
226 0.69
227 0.75
228 0.77
229 0.8
230 0.84
231 0.84
232 0.81
233 0.75
234 0.68
235 0.6
236 0.52
237 0.43
238 0.35
239 0.27
240 0.19
241 0.16
242 0.13
243 0.12
244 0.13
245 0.12
246 0.11
247 0.14
248 0.15
249 0.15
250 0.19
251 0.22
252 0.21
253 0.26
254 0.27
255 0.24
256 0.23
257 0.22
258 0.17
259 0.13
260 0.12
261 0.06
262 0.05
263 0.04
264 0.03
265 0.03
266 0.04
267 0.06
268 0.07
269 0.08
270 0.08
271 0.1
272 0.13
273 0.14
274 0.18
275 0.18
276 0.18
277 0.19
278 0.25
279 0.24
280 0.23
281 0.25
282 0.27
283 0.27
284 0.34
285 0.38
286 0.4
287 0.48
288 0.55
289 0.59
290 0.58
291 0.59