Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137NR92

Protein Details
Accession A0A137NR92   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
66-96SSDLSIYKPINKKRRRKEKSARYNKLPPTPDHydrophilic
NLS Segment(s)
PositionSequence
75-87INKKRRRKEKSAR
Subcellular Location(s) nucl 6.5, plas 6, cyto_nucl 5, mito 4, E.R. 3, cyto 2.5, extr 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTYPYYSYNSSSTFGSSPADIFVFAFIIAVILFIFGGLFALIINHRKKKEESYINRFVFNSKLLFSSDLSIYKPINKKRRRKEKSARYNKLPPTPDEMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.15
4 0.13
5 0.13
6 0.13
7 0.1
8 0.09
9 0.09
10 0.08
11 0.07
12 0.06
13 0.05
14 0.04
15 0.04
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.03
28 0.04
29 0.09
30 0.14
31 0.18
32 0.2
33 0.22
34 0.24
35 0.29
36 0.37
37 0.42
38 0.47
39 0.51
40 0.6
41 0.58
42 0.58
43 0.53
44 0.45
45 0.37
46 0.3
47 0.22
48 0.13
49 0.13
50 0.13
51 0.14
52 0.13
53 0.14
54 0.14
55 0.14
56 0.14
57 0.16
58 0.15
59 0.21
60 0.28
61 0.35
62 0.44
63 0.53
64 0.62
65 0.71
66 0.82
67 0.83
68 0.87
69 0.89
70 0.9
71 0.92
72 0.93
73 0.92
74 0.89
75 0.9
76 0.88
77 0.86
78 0.79
79 0.7