Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137P2D8

Protein Details
Accession A0A137P2D8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-26KYVYPTSRLRKCLKKHEPNLSLSKRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028847  CENP-W  
IPR009072  Histone-fold  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0051382  P:kinetochore assembly  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF15510  CENP-W  
Amino Acid Sequences MKYVYPTSRLRKCLKKHEPNLSLSKRAEVMVYLNYILFLKQLVEEAKLESRSSYNSNSIQPEHVERVLEKVLNKHQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.82
4 0.85
5 0.83
6 0.79
7 0.81
8 0.74
9 0.69
10 0.58
11 0.51
12 0.41
13 0.35
14 0.29
15 0.2
16 0.17
17 0.11
18 0.12
19 0.1
20 0.09
21 0.09
22 0.08
23 0.08
24 0.06
25 0.05
26 0.04
27 0.04
28 0.06
29 0.06
30 0.07
31 0.08
32 0.1
33 0.12
34 0.13
35 0.13
36 0.12
37 0.13
38 0.14
39 0.17
40 0.19
41 0.21
42 0.23
43 0.26
44 0.29
45 0.29
46 0.29
47 0.28
48 0.3
49 0.29
50 0.28
51 0.26
52 0.23
53 0.26
54 0.27
55 0.27
56 0.25
57 0.27