Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137NRG4

Protein Details
Accession A0A137NRG4    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
140-161LGYIRDKTSKHKKVKSISSAGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.666, nucl 12.5, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR011767  GLR_AS  
IPR002109  Glutaredoxin  
IPR014025  Glutaredoxin_subgr  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00462  Glutaredoxin  
PROSITE View protein in PROSITE  
PS00195  GLUTAREDOXIN_1  
PS51354  GLUTAREDOXIN_2  
Amino Acid Sequences MINGCPPPKAPTSSGFSRYLPSIFRHTDPSLAPITQINPKFGNMRSREIINFLVQKHQVMVFLQSNCPYCVKVLEVLKQCKIKFFAIDLLKLDRGSNLIKSLFKITPMTTVPIIFINGELLGGYDDLMTARRSGQLQLQLGYIRDKTSKHKKVKSISSAGSDCSTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.41
4 0.39
5 0.38
6 0.34
7 0.3
8 0.27
9 0.29
10 0.3
11 0.3
12 0.34
13 0.33
14 0.35
15 0.33
16 0.33
17 0.28
18 0.25
19 0.23
20 0.19
21 0.2
22 0.24
23 0.25
24 0.25
25 0.23
26 0.25
27 0.27
28 0.29
29 0.36
30 0.32
31 0.36
32 0.35
33 0.36
34 0.35
35 0.35
36 0.33
37 0.28
38 0.27
39 0.22
40 0.25
41 0.23
42 0.23
43 0.21
44 0.2
45 0.16
46 0.14
47 0.17
48 0.16
49 0.17
50 0.17
51 0.19
52 0.2
53 0.2
54 0.2
55 0.16
56 0.12
57 0.12
58 0.12
59 0.14
60 0.15
61 0.2
62 0.26
63 0.29
64 0.32
65 0.36
66 0.35
67 0.34
68 0.34
69 0.28
70 0.23
71 0.21
72 0.24
73 0.21
74 0.22
75 0.2
76 0.2
77 0.19
78 0.19
79 0.17
80 0.1
81 0.11
82 0.11
83 0.11
84 0.11
85 0.12
86 0.12
87 0.14
88 0.18
89 0.16
90 0.17
91 0.18
92 0.16
93 0.18
94 0.19
95 0.2
96 0.16
97 0.16
98 0.15
99 0.14
100 0.14
101 0.1
102 0.09
103 0.07
104 0.06
105 0.06
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.06
115 0.06
116 0.06
117 0.07
118 0.1
119 0.11
120 0.12
121 0.17
122 0.23
123 0.25
124 0.25
125 0.26
126 0.25
127 0.25
128 0.27
129 0.23
130 0.19
131 0.19
132 0.21
133 0.29
134 0.39
135 0.48
136 0.55
137 0.63
138 0.69
139 0.76
140 0.84
141 0.84
142 0.81
143 0.75
144 0.73
145 0.66
146 0.59
147 0.52