Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137NX91

Protein Details
Accession A0A137NX91    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MMAHMPCDRCRQKRVRCDRDLKQCSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MMAHMPCDRCRQKRVRCDRDLKQCSHCEKHGEKCTYKYVLKKRGPKTKVDQDLVELEKILNSRKSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.83
4 0.86
5 0.86
6 0.87
7 0.84
8 0.77
9 0.73
10 0.7
11 0.67
12 0.63
13 0.56
14 0.52
15 0.5
16 0.54
17 0.56
18 0.54
19 0.49
20 0.47
21 0.49
22 0.47
23 0.45
24 0.44
25 0.45
26 0.5
27 0.55
28 0.62
29 0.66
30 0.72
31 0.72
32 0.71
33 0.71
34 0.71
35 0.73
36 0.67
37 0.58
38 0.51
39 0.54
40 0.49
41 0.4
42 0.3
43 0.21
44 0.19
45 0.2
46 0.21
47 0.21