Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PHJ0

Protein Details
Accession A0A137PHJ0   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-65KASSINENNKKKKRKEKEKTGKNRSGIVHydrophilic
NLS Segment(s)
PositionSequence
46-61NKKKKRKEKEKTGKNR
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MILLENRGIDPLPSIINNDPKNSLINSNPREEASSKLKASSINENNKKKKRKEKEKTGKNRSGIVDMDYYEKYYDMDYNYNHVYRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.26
4 0.28
5 0.28
6 0.29
7 0.28
8 0.29
9 0.27
10 0.27
11 0.24
12 0.31
13 0.32
14 0.34
15 0.34
16 0.32
17 0.33
18 0.31
19 0.3
20 0.27
21 0.29
22 0.26
23 0.25
24 0.26
25 0.25
26 0.27
27 0.31
28 0.33
29 0.38
30 0.47
31 0.54
32 0.63
33 0.69
34 0.76
35 0.75
36 0.78
37 0.79
38 0.82
39 0.84
40 0.87
41 0.9
42 0.92
43 0.94
44 0.94
45 0.9
46 0.82
47 0.77
48 0.67
49 0.59
50 0.49
51 0.4
52 0.32
53 0.25
54 0.25
55 0.2
56 0.19
57 0.16
58 0.15
59 0.13
60 0.12
61 0.14
62 0.14
63 0.18
64 0.18
65 0.23
66 0.28
67 0.28