Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P3Z2

Protein Details
Accession A0A137P3Z2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-26GEPIVRTKKRARPGTKALRDIRKYBasic
NLS Segment(s)
PositionSequence
9-19TKKRARPGTKA
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000164  Histone_H3/CENP-A  
Gene Ontology GO:0061638  C:CENP-A containing chromatin  
GO:0000779  C:condensed chromosome, centromeric region  
GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
GO:0034080  P:CENP-A containing chromatin assembly  
Pfam View protein in Pfam  
PF00125  Histone  
Amino Acid Sequences KPGEPIVRTKKRARPGTKALRDIRKYQKSTDLLIPKLPFSRVVRDIANELFGAGMSYGGSDRGTYGSGIRWQSTALQALQEASEAFLVHLLEDANLCAIHAKRVTIMDRDIRLARRIRGISYGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.83
4 0.83
5 0.83
6 0.82
7 0.81
8 0.78
9 0.77
10 0.77
11 0.75
12 0.69
13 0.64
14 0.65
15 0.57
16 0.57
17 0.57
18 0.52
19 0.44
20 0.46
21 0.43
22 0.36
23 0.34
24 0.31
25 0.28
26 0.24
27 0.29
28 0.26
29 0.28
30 0.27
31 0.27
32 0.28
33 0.23
34 0.22
35 0.15
36 0.12
37 0.09
38 0.08
39 0.07
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.03
48 0.04
49 0.04
50 0.05
51 0.05
52 0.06
53 0.07
54 0.11
55 0.12
56 0.12
57 0.12
58 0.12
59 0.13
60 0.14
61 0.15
62 0.11
63 0.1
64 0.1
65 0.1
66 0.1
67 0.09
68 0.07
69 0.05
70 0.06
71 0.05
72 0.05
73 0.06
74 0.06
75 0.05
76 0.06
77 0.06
78 0.05
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.08
85 0.08
86 0.12
87 0.13
88 0.14
89 0.15
90 0.2
91 0.23
92 0.23
93 0.27
94 0.3
95 0.31
96 0.35
97 0.37
98 0.36
99 0.4
100 0.42
101 0.41
102 0.43
103 0.43
104 0.41