Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PC15

Protein Details
Accession A0A137PC15    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-68KAGDKYKTPKLTKSKLKKSKLEVQSNTHydrophilic
202-222IPNRNHPQTRRSKRKEEELTIHydrophilic
NLS Segment(s)
PositionSequence
31-61PKESKLQAKKLKAGDKYKTPKLTKSKLKKSK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005654  C:nucleoplasm  
Pfam View protein in Pfam  
PF08598  Sds3  
Amino Acid Sequences MGRNKNIKTNTTTATTNNGGGSNNSTPVKIPKESKLQAKKLKAGDKYKTPKLTKSKLKKSKLEVQSNTEALLKFREKFITNLSNCIHQFEQDCLHDYQYKLKEIDTQLKLIHDNPSKVFSEKYDQIGQLRDYKIYRDELDKNYKLREIEEEYKNLLIKAEKNYQNENETVRKRLLGYVQDKRTRLRDEMNNMEISEEYTVEIPNRNHPQTRRSKRKEEELTISYNKVPKVELNPKLFTLRQDQVSEDFDIFYNGNGQQMLGKRRNLRNGKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.33
4 0.28
5 0.26
6 0.23
7 0.22
8 0.26
9 0.21
10 0.24
11 0.23
12 0.22
13 0.23
14 0.29
15 0.33
16 0.33
17 0.36
18 0.38
19 0.47
20 0.53
21 0.61
22 0.65
23 0.69
24 0.72
25 0.75
26 0.75
27 0.73
28 0.75
29 0.73
30 0.72
31 0.69
32 0.71
33 0.72
34 0.74
35 0.75
36 0.71
37 0.71
38 0.72
39 0.75
40 0.75
41 0.77
42 0.8
43 0.81
44 0.86
45 0.85
46 0.83
47 0.83
48 0.83
49 0.82
50 0.75
51 0.72
52 0.69
53 0.61
54 0.54
55 0.46
56 0.37
57 0.27
58 0.28
59 0.24
60 0.19
61 0.2
62 0.23
63 0.22
64 0.23
65 0.3
66 0.34
67 0.32
68 0.37
69 0.35
70 0.37
71 0.36
72 0.38
73 0.31
74 0.23
75 0.24
76 0.2
77 0.23
78 0.18
79 0.22
80 0.19
81 0.21
82 0.22
83 0.21
84 0.27
85 0.27
86 0.29
87 0.26
88 0.25
89 0.29
90 0.29
91 0.38
92 0.31
93 0.3
94 0.27
95 0.28
96 0.29
97 0.24
98 0.29
99 0.22
100 0.23
101 0.22
102 0.24
103 0.24
104 0.24
105 0.23
106 0.18
107 0.2
108 0.21
109 0.24
110 0.23
111 0.23
112 0.24
113 0.25
114 0.25
115 0.25
116 0.23
117 0.21
118 0.19
119 0.19
120 0.2
121 0.2
122 0.19
123 0.18
124 0.22
125 0.26
126 0.34
127 0.36
128 0.35
129 0.34
130 0.35
131 0.31
132 0.27
133 0.26
134 0.24
135 0.28
136 0.29
137 0.29
138 0.28
139 0.29
140 0.28
141 0.24
142 0.18
143 0.13
144 0.14
145 0.18
146 0.25
147 0.3
148 0.32
149 0.36
150 0.37
151 0.38
152 0.36
153 0.35
154 0.34
155 0.31
156 0.31
157 0.28
158 0.27
159 0.25
160 0.26
161 0.27
162 0.27
163 0.32
164 0.38
165 0.46
166 0.5
167 0.51
168 0.51
169 0.53
170 0.49
171 0.44
172 0.43
173 0.43
174 0.44
175 0.5
176 0.5
177 0.45
178 0.41
179 0.38
180 0.3
181 0.24
182 0.17
183 0.1
184 0.08
185 0.07
186 0.08
187 0.08
188 0.13
189 0.14
190 0.22
191 0.29
192 0.32
193 0.37
194 0.4
195 0.49
196 0.55
197 0.66
198 0.68
199 0.7
200 0.77
201 0.77
202 0.85
203 0.84
204 0.8
205 0.77
206 0.69
207 0.68
208 0.6
209 0.56
210 0.48
211 0.42
212 0.36
213 0.29
214 0.26
215 0.24
216 0.31
217 0.38
218 0.44
219 0.46
220 0.48
221 0.49
222 0.53
223 0.5
224 0.43
225 0.41
226 0.39
227 0.37
228 0.36
229 0.36
230 0.35
231 0.37
232 0.36
233 0.28
234 0.24
235 0.19
236 0.19
237 0.17
238 0.14
239 0.14
240 0.13
241 0.14
242 0.13
243 0.13
244 0.15
245 0.22
246 0.3
247 0.33
248 0.4
249 0.48
250 0.56
251 0.66
252 0.72