Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JHP1

Protein Details
Accession G3JHP1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
205-224KKEAGRPASPKSPKKSKKRDBasic
NLS Segment(s)
PositionSequence
205-224KKEAGRPASPKSPKKSKKRD
Subcellular Location(s) plas 23, mito 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013248  Psh3/Shr3  
Gene Ontology GO:0016020  C:membrane  
KEGG cmt:CCM_05905  -  
Pfam View protein in Pfam  
PF08229  SHR3_chaperone  
Amino Acid Sequences MGFFDGWVDSSKTTRSSNYRGSGSFATLMIIGPTCFFLGILFASFPYDFPLLWSKEPLAADFLPQLEVHLKFMHAAPPLIHRMLNIMVFVAFAGLLIKLFRPSEANFLFDGASLILYVIGAATYMTNIVRGLRALTDGVWDQPEFAKTRRGESDGEYILGKEDSLRVMSASNTILALVLIGVLVLQAGQWYAEKRDRDDDEPAEKKEAGRPASPKSPKKSKKRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.38
4 0.45
5 0.49
6 0.51
7 0.48
8 0.51
9 0.45
10 0.41
11 0.35
12 0.26
13 0.21
14 0.17
15 0.16
16 0.12
17 0.11
18 0.08
19 0.07
20 0.08
21 0.07
22 0.07
23 0.07
24 0.06
25 0.06
26 0.07
27 0.07
28 0.06
29 0.06
30 0.09
31 0.09
32 0.09
33 0.11
34 0.11
35 0.1
36 0.13
37 0.19
38 0.2
39 0.21
40 0.22
41 0.19
42 0.23
43 0.23
44 0.21
45 0.19
46 0.17
47 0.17
48 0.16
49 0.16
50 0.13
51 0.13
52 0.13
53 0.12
54 0.13
55 0.13
56 0.12
57 0.12
58 0.12
59 0.13
60 0.16
61 0.13
62 0.13
63 0.12
64 0.16
65 0.19
66 0.18
67 0.18
68 0.14
69 0.15
70 0.15
71 0.15
72 0.11
73 0.08
74 0.07
75 0.07
76 0.07
77 0.05
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.05
86 0.05
87 0.06
88 0.08
89 0.09
90 0.16
91 0.16
92 0.18
93 0.16
94 0.17
95 0.17
96 0.14
97 0.14
98 0.07
99 0.06
100 0.04
101 0.04
102 0.03
103 0.03
104 0.03
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.03
112 0.03
113 0.03
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.08
126 0.09
127 0.08
128 0.08
129 0.09
130 0.11
131 0.12
132 0.13
133 0.19
134 0.19
135 0.24
136 0.26
137 0.27
138 0.27
139 0.28
140 0.34
141 0.27
142 0.27
143 0.23
144 0.2
145 0.18
146 0.17
147 0.13
148 0.07
149 0.07
150 0.07
151 0.08
152 0.08
153 0.07
154 0.08
155 0.09
156 0.1
157 0.1
158 0.09
159 0.08
160 0.08
161 0.08
162 0.07
163 0.06
164 0.04
165 0.03
166 0.03
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.03
176 0.05
177 0.07
178 0.13
179 0.19
180 0.22
181 0.25
182 0.34
183 0.38
184 0.4
185 0.45
186 0.46
187 0.5
188 0.53
189 0.52
190 0.48
191 0.44
192 0.41
193 0.41
194 0.42
195 0.37
196 0.38
197 0.4
198 0.44
199 0.53
200 0.62
201 0.64
202 0.66
203 0.74
204 0.77