Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PGJ8

Protein Details
Accession A0A137PGJ8   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
106-133NSNVASQKPKPTKLKPIKYWKVPDRTYFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7, cyto 4, pero 2
Family & Domain DBs
Amino Acid Sequences MLPITLIYSFVTFVNCYYIQNQIPNKSINTYRLWFETFLNLIIEAKNIHTANEYNAPRSNKENNNNLTEKSQSYKVIAQAINSNRTISSNGNNTKSNNEAAKNQTNSNVASQKPKPTKLKPIKYWKVPDRTYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.15
4 0.16
5 0.21
6 0.22
7 0.29
8 0.33
9 0.33
10 0.36
11 0.37
12 0.37
13 0.35
14 0.37
15 0.34
16 0.34
17 0.31
18 0.3
19 0.3
20 0.31
21 0.27
22 0.25
23 0.24
24 0.2
25 0.18
26 0.16
27 0.14
28 0.13
29 0.11
30 0.11
31 0.08
32 0.08
33 0.12
34 0.11
35 0.12
36 0.13
37 0.13
38 0.15
39 0.23
40 0.23
41 0.2
42 0.25
43 0.27
44 0.27
45 0.31
46 0.36
47 0.35
48 0.41
49 0.46
50 0.45
51 0.49
52 0.48
53 0.45
54 0.38
55 0.32
56 0.27
57 0.22
58 0.21
59 0.16
60 0.17
61 0.18
62 0.19
63 0.23
64 0.22
65 0.2
66 0.24
67 0.26
68 0.28
69 0.26
70 0.24
71 0.19
72 0.19
73 0.21
74 0.16
75 0.18
76 0.23
77 0.28
78 0.31
79 0.33
80 0.34
81 0.34
82 0.35
83 0.34
84 0.3
85 0.27
86 0.28
87 0.33
88 0.4
89 0.4
90 0.39
91 0.38
92 0.37
93 0.36
94 0.37
95 0.35
96 0.29
97 0.34
98 0.37
99 0.43
100 0.49
101 0.56
102 0.59
103 0.62
104 0.71
105 0.74
106 0.81
107 0.81
108 0.85
109 0.87
110 0.87
111 0.9
112 0.88
113 0.87