Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P3A8

Protein Details
Accession A0A137P3A8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KQKPKTHFKRLDQILKDRKABasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR016082  Ribosomal_L30_ferredoxin-like  
IPR039699  Ribosomal_L7/L30  
IPR035808  Ribosomal_L7_euk_arc  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
CDD cd01657  Ribosomal_L7_archeal_euk  
Amino Acid Sequences KQKPKTHFKRLDQILKDRKAFEGEKRRLNRLENSQVQLPDFKDAKCLFVIRSRKINKIPEQVQKVLKEFRLTSLNFGVFIKPTEDNIKKIKLISPYVFYGEPSLKSIKNLVLKRGFTKKDGKVVPLDNNTIIEETLGDLGFICLDDLIHELSTNGENFDKISGFLVPFRFSKLADKKSKKGVVSSTVMEKQTPKAKSEFINRILMRLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.75
4 0.66
5 0.58
6 0.55
7 0.51
8 0.51
9 0.52
10 0.52
11 0.57
12 0.61
13 0.65
14 0.64
15 0.66
16 0.63
17 0.62
18 0.65
19 0.61
20 0.61
21 0.58
22 0.55
23 0.51
24 0.46
25 0.37
26 0.34
27 0.3
28 0.25
29 0.28
30 0.28
31 0.28
32 0.27
33 0.27
34 0.22
35 0.28
36 0.36
37 0.32
38 0.42
39 0.44
40 0.49
41 0.55
42 0.62
43 0.61
44 0.64
45 0.67
46 0.65
47 0.68
48 0.66
49 0.64
50 0.58
51 0.54
52 0.48
53 0.42
54 0.37
55 0.31
56 0.29
57 0.3
58 0.27
59 0.27
60 0.26
61 0.25
62 0.22
63 0.22
64 0.19
65 0.14
66 0.14
67 0.13
68 0.1
69 0.12
70 0.19
71 0.2
72 0.23
73 0.26
74 0.28
75 0.26
76 0.27
77 0.29
78 0.25
79 0.28
80 0.26
81 0.25
82 0.24
83 0.25
84 0.24
85 0.2
86 0.18
87 0.15
88 0.14
89 0.13
90 0.14
91 0.12
92 0.13
93 0.14
94 0.16
95 0.23
96 0.23
97 0.27
98 0.3
99 0.31
100 0.35
101 0.42
102 0.39
103 0.36
104 0.43
105 0.4
106 0.43
107 0.43
108 0.41
109 0.37
110 0.39
111 0.41
112 0.36
113 0.34
114 0.27
115 0.26
116 0.24
117 0.2
118 0.16
119 0.1
120 0.07
121 0.06
122 0.07
123 0.06
124 0.05
125 0.05
126 0.05
127 0.05
128 0.04
129 0.04
130 0.03
131 0.03
132 0.03
133 0.04
134 0.05
135 0.05
136 0.06
137 0.06
138 0.07
139 0.09
140 0.09
141 0.09
142 0.08
143 0.09
144 0.09
145 0.1
146 0.09
147 0.08
148 0.09
149 0.09
150 0.1
151 0.13
152 0.14
153 0.15
154 0.16
155 0.2
156 0.2
157 0.19
158 0.29
159 0.35
160 0.43
161 0.52
162 0.59
163 0.6
164 0.69
165 0.75
166 0.67
167 0.63
168 0.59
169 0.55
170 0.52
171 0.5
172 0.47
173 0.45
174 0.44
175 0.4
176 0.36
177 0.37
178 0.4
179 0.4
180 0.36
181 0.34
182 0.38
183 0.44
184 0.51
185 0.54
186 0.5
187 0.58
188 0.55