Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PJ29

Protein Details
Accession A0A137PJ29    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-96RITRENWRNHMRKSKNYRDYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025337  Questin_oxidase-like  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF14027  Questin_oxidase  
Amino Acid Sequences MMNNLNQNDPLSKLKDLVEYNNKFKITSTDKTSKHYMNHTIHVLCLMYYCGASPDQLQKYHDQDISNFEKLPAPNLRITRENWRNHMRKSKNYRDYLDFFQHEISQLGALDTFQTYFPILIPTLAGAALHPLIHISYGIEFNLPQLLAEGLAYACCYNLSIENIIRDSPLTSEFLTISNIFDQISSLYSPKVGEEFNIMSRVRSVIKKYGREISLLVSSWELKPRDENLREKLNELTTWSIKLFAESNHKNHFDFILVHQIEAIQSFRVLSPLLTIEDKTKLLRLNFATLLMLFLAQGSPKLNSASILDYKPDYLVDIRTWKDLLSEIIIEPDEHLIPLIRALYQFDKETGYKDTSYNFNVALKTFEAFKLGGGWSYRGIGYYQRKSNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.35
4 0.4
5 0.45
6 0.48
7 0.52
8 0.56
9 0.54
10 0.47
11 0.45
12 0.45
13 0.41
14 0.42
15 0.45
16 0.49
17 0.51
18 0.56
19 0.62
20 0.59
21 0.57
22 0.58
23 0.58
24 0.54
25 0.57
26 0.58
27 0.51
28 0.46
29 0.42
30 0.34
31 0.24
32 0.19
33 0.15
34 0.1
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.13
41 0.21
42 0.25
43 0.28
44 0.3
45 0.34
46 0.39
47 0.44
48 0.44
49 0.36
50 0.34
51 0.38
52 0.42
53 0.38
54 0.34
55 0.28
56 0.3
57 0.29
58 0.34
59 0.32
60 0.29
61 0.32
62 0.35
63 0.38
64 0.37
65 0.4
66 0.45
67 0.48
68 0.5
69 0.53
70 0.6
71 0.63
72 0.66
73 0.74
74 0.71
75 0.72
76 0.77
77 0.8
78 0.79
79 0.79
80 0.77
81 0.73
82 0.71
83 0.66
84 0.63
85 0.54
86 0.45
87 0.4
88 0.35
89 0.29
90 0.24
91 0.18
92 0.11
93 0.1
94 0.09
95 0.07
96 0.06
97 0.06
98 0.06
99 0.07
100 0.06
101 0.07
102 0.07
103 0.07
104 0.07
105 0.08
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.06
112 0.06
113 0.04
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.07
129 0.08
130 0.07
131 0.06
132 0.06
133 0.06
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.03
143 0.04
144 0.04
145 0.06
146 0.07
147 0.09
148 0.1
149 0.11
150 0.12
151 0.12
152 0.11
153 0.1
154 0.09
155 0.08
156 0.08
157 0.09
158 0.08
159 0.09
160 0.09
161 0.1
162 0.11
163 0.1
164 0.1
165 0.09
166 0.09
167 0.08
168 0.07
169 0.07
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.07
176 0.07
177 0.07
178 0.08
179 0.07
180 0.06
181 0.09
182 0.1
183 0.1
184 0.14
185 0.14
186 0.13
187 0.13
188 0.14
189 0.14
190 0.15
191 0.17
192 0.21
193 0.27
194 0.31
195 0.33
196 0.38
197 0.37
198 0.35
199 0.33
200 0.27
201 0.23
202 0.2
203 0.18
204 0.12
205 0.12
206 0.12
207 0.17
208 0.16
209 0.14
210 0.16
211 0.19
212 0.28
213 0.32
214 0.37
215 0.36
216 0.44
217 0.44
218 0.43
219 0.42
220 0.34
221 0.29
222 0.26
223 0.25
224 0.17
225 0.18
226 0.17
227 0.16
228 0.14
229 0.15
230 0.14
231 0.13
232 0.22
233 0.25
234 0.29
235 0.33
236 0.35
237 0.35
238 0.34
239 0.32
240 0.24
241 0.22
242 0.19
243 0.23
244 0.21
245 0.21
246 0.2
247 0.19
248 0.17
249 0.17
250 0.16
251 0.05
252 0.05
253 0.06
254 0.06
255 0.07
256 0.07
257 0.06
258 0.07
259 0.08
260 0.1
261 0.1
262 0.11
263 0.12
264 0.15
265 0.16
266 0.15
267 0.17
268 0.2
269 0.2
270 0.25
271 0.25
272 0.27
273 0.27
274 0.27
275 0.24
276 0.2
277 0.19
278 0.13
279 0.11
280 0.06
281 0.06
282 0.05
283 0.05
284 0.06
285 0.07
286 0.08
287 0.09
288 0.1
289 0.1
290 0.11
291 0.13
292 0.16
293 0.19
294 0.19
295 0.2
296 0.19
297 0.2
298 0.19
299 0.17
300 0.15
301 0.12
302 0.14
303 0.16
304 0.21
305 0.22
306 0.24
307 0.24
308 0.22
309 0.21
310 0.2
311 0.18
312 0.15
313 0.15
314 0.13
315 0.15
316 0.15
317 0.14
318 0.14
319 0.14
320 0.12
321 0.1
322 0.1
323 0.09
324 0.09
325 0.1
326 0.1
327 0.09
328 0.09
329 0.13
330 0.17
331 0.19
332 0.2
333 0.2
334 0.24
335 0.23
336 0.26
337 0.27
338 0.26
339 0.25
340 0.25
341 0.28
342 0.29
343 0.31
344 0.3
345 0.27
346 0.27
347 0.26
348 0.26
349 0.25
350 0.21
351 0.19
352 0.19
353 0.18
354 0.17
355 0.16
356 0.16
357 0.16
358 0.16
359 0.19
360 0.18
361 0.19
362 0.18
363 0.2
364 0.2
365 0.17
366 0.18
367 0.23
368 0.31
369 0.39