Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137NTT9

Protein Details
Accession A0A137NTT9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
113-141ILNHKVNNPKFKIKKFKKSSKGKDDGFLFHydrophilic
NLS Segment(s)
PositionSequence
122-134KFKIKKFKKSSKG
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSKSLSKSGLDDLLNFYKPSTEESKPTSSKSELVKKLPKTKEGLKKLRHQLKYQHSQTSVQARNKVKGVEITLLDKLKQKQALEGDKLTKNLAAITQNKKKQSETLHKFQDNILNHKVNNPKFKIKKFKKSSKGKDDGFLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.24
4 0.21
5 0.21
6 0.25
7 0.25
8 0.23
9 0.26
10 0.32
11 0.4
12 0.4
13 0.42
14 0.42
15 0.38
16 0.4
17 0.43
18 0.48
19 0.45
20 0.51
21 0.56
22 0.59
23 0.67
24 0.66
25 0.63
26 0.58
27 0.62
28 0.64
29 0.67
30 0.69
31 0.66
32 0.71
33 0.76
34 0.8
35 0.75
36 0.69
37 0.68
38 0.69
39 0.72
40 0.67
41 0.62
42 0.55
43 0.52
44 0.52
45 0.52
46 0.49
47 0.43
48 0.46
49 0.42
50 0.43
51 0.43
52 0.39
53 0.3
54 0.25
55 0.23
56 0.18
57 0.16
58 0.16
59 0.16
60 0.16
61 0.16
62 0.18
63 0.18
64 0.19
65 0.22
66 0.2
67 0.22
68 0.28
69 0.33
70 0.32
71 0.34
72 0.35
73 0.33
74 0.34
75 0.3
76 0.24
77 0.18
78 0.16
79 0.15
80 0.15
81 0.2
82 0.28
83 0.37
84 0.41
85 0.46
86 0.48
87 0.47
88 0.47
89 0.5
90 0.53
91 0.52
92 0.56
93 0.61
94 0.6
95 0.6
96 0.56
97 0.54
98 0.47
99 0.46
100 0.44
101 0.38
102 0.37
103 0.43
104 0.49
105 0.48
106 0.53
107 0.53
108 0.57
109 0.62
110 0.71
111 0.76
112 0.78
113 0.82
114 0.84
115 0.89
116 0.89
117 0.91
118 0.93
119 0.92
120 0.92
121 0.84