Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PFT4

Protein Details
Accession A0A137PFT4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MDLPTHKKHKSQTRQLKNYRDKLEKYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MDLPTHKKHKSQTRQLKNYRDKLEKYEVFKSIWNKTFESQIEMIKKLIENLENLLKLSSEFLDKIDEIRPNIIYQNTELNDIEQMPQVSQNSDYTTDELNKSNWNASYDLAEKTHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.91
3 0.92
4 0.91
5 0.9
6 0.87
7 0.84
8 0.76
9 0.72
10 0.73
11 0.68
12 0.63
13 0.59
14 0.52
15 0.46
16 0.47
17 0.45
18 0.43
19 0.43
20 0.41
21 0.37
22 0.36
23 0.4
24 0.36
25 0.36
26 0.29
27 0.28
28 0.28
29 0.27
30 0.26
31 0.21
32 0.2
33 0.17
34 0.17
35 0.13
36 0.11
37 0.12
38 0.15
39 0.14
40 0.14
41 0.13
42 0.11
43 0.1
44 0.1
45 0.08
46 0.06
47 0.06
48 0.06
49 0.08
50 0.08
51 0.09
52 0.12
53 0.13
54 0.13
55 0.14
56 0.15
57 0.14
58 0.16
59 0.15
60 0.13
61 0.12
62 0.18
63 0.17
64 0.19
65 0.18
66 0.17
67 0.16
68 0.16
69 0.16
70 0.12
71 0.12
72 0.1
73 0.13
74 0.13
75 0.13
76 0.14
77 0.14
78 0.15
79 0.17
80 0.18
81 0.17
82 0.2
83 0.21
84 0.22
85 0.23
86 0.22
87 0.24
88 0.24
89 0.27
90 0.26
91 0.26
92 0.25
93 0.24
94 0.27
95 0.25
96 0.26