Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137P757

Protein Details
Accession A0A137P757    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-60VRSATGRKVLKRRLHKGRKRLSHBasic
NLS Segment(s)
PositionSequence
27-60RRKRKHGFLARVRSATGRKVLKRRLHKGRKRLSH
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences QLPSLLSQPQQVRFVTYGNEYQPSNIRRKRKHGFLARVRSATGRKVLKRRLHKGRKRLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.24
4 0.23
5 0.2
6 0.22
7 0.19
8 0.19
9 0.25
10 0.26
11 0.33
12 0.35
13 0.43
14 0.46
15 0.55
16 0.6
17 0.62
18 0.68
19 0.68
20 0.73
21 0.73
22 0.77
23 0.73
24 0.67
25 0.59
26 0.53
27 0.46
28 0.39
29 0.37
30 0.35
31 0.38
32 0.46
33 0.55
34 0.61
35 0.69
36 0.76
37 0.8
38 0.83
39 0.86
40 0.88