Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P2D9

Protein Details
Accession A0A137P2D9   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-41FKVQDKPKKTINQKVIHRDLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR015637  MUG/TDG  
IPR005122  Uracil-DNA_glycosylase-like  
IPR036895  Uracil-DNA_glycosylase-like_sf  
Gene Ontology GO:0000700  F:mismatch base pair DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF03167  UDG  
CDD cd10028  UDG-F2_TDG_MUG  
Amino Acid Sequences MKNSTQTSALRRPSRILNKTGFKVQDKPKKTINQKVIHRDLPLLPDRLNQSMKILFIGINPGVLSSQKGRHFSNPRNLFWSLLFESGLISSKLTCEDDERILEEYGYGLTNLCVRPTVSMSDLSKDELRNGVPILKQKIIEYKPQVCCFLGYAVYRYFIKDMKKSIVPGFQFDFENKTLGCKMFAAPSTSGIATGFTKKDRLKCMAELNNWVKKNCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.61
4 0.6
5 0.62
6 0.64
7 0.68
8 0.63
9 0.57
10 0.6
11 0.63
12 0.65
13 0.62
14 0.63
15 0.64
16 0.68
17 0.72
18 0.73
19 0.73
20 0.72
21 0.76
22 0.81
23 0.8
24 0.73
25 0.65
26 0.58
27 0.5
28 0.47
29 0.43
30 0.36
31 0.29
32 0.29
33 0.31
34 0.33
35 0.33
36 0.26
37 0.25
38 0.25
39 0.24
40 0.21
41 0.18
42 0.13
43 0.12
44 0.15
45 0.12
46 0.1
47 0.1
48 0.09
49 0.09
50 0.09
51 0.1
52 0.1
53 0.16
54 0.2
55 0.24
56 0.26
57 0.34
58 0.42
59 0.48
60 0.56
61 0.56
62 0.53
63 0.54
64 0.53
65 0.45
66 0.37
67 0.35
68 0.26
69 0.2
70 0.18
71 0.13
72 0.13
73 0.12
74 0.13
75 0.08
76 0.06
77 0.06
78 0.06
79 0.07
80 0.08
81 0.08
82 0.09
83 0.11
84 0.12
85 0.13
86 0.14
87 0.14
88 0.13
89 0.13
90 0.11
91 0.09
92 0.08
93 0.07
94 0.06
95 0.04
96 0.04
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.09
104 0.1
105 0.09
106 0.13
107 0.13
108 0.15
109 0.15
110 0.16
111 0.17
112 0.16
113 0.15
114 0.14
115 0.13
116 0.12
117 0.13
118 0.13
119 0.13
120 0.18
121 0.21
122 0.22
123 0.22
124 0.22
125 0.3
126 0.29
127 0.34
128 0.36
129 0.4
130 0.44
131 0.46
132 0.47
133 0.39
134 0.37
135 0.31
136 0.26
137 0.21
138 0.16
139 0.16
140 0.15
141 0.17
142 0.16
143 0.16
144 0.17
145 0.17
146 0.21
147 0.23
148 0.26
149 0.29
150 0.32
151 0.34
152 0.36
153 0.39
154 0.35
155 0.35
156 0.34
157 0.31
158 0.29
159 0.27
160 0.28
161 0.22
162 0.23
163 0.18
164 0.19
165 0.2
166 0.19
167 0.2
168 0.16
169 0.17
170 0.2
171 0.22
172 0.23
173 0.21
174 0.22
175 0.24
176 0.23
177 0.22
178 0.17
179 0.16
180 0.14
181 0.18
182 0.19
183 0.18
184 0.25
185 0.3
186 0.37
187 0.42
188 0.47
189 0.47
190 0.51
191 0.59
192 0.6
193 0.59
194 0.62
195 0.63
196 0.66
197 0.64