Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P6Y6

Protein Details
Accession A0A137P6Y6    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
129-151QVVEKKNKKNVKSKTASNTKKLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012098  SND3_fun  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0045047  P:protein targeting to ER  
Pfam View protein in Pfam  
PF10032  Pho88  
Amino Acid Sequences MYLTSNLIYYGILYNVYQKIQSKNDETELTYVENPPMFSENSPVTIISTYTEYDTDELYKFIKTSFMSLAMVTFLHLRMGYIQPLFIQSLMPFKSLYSHPLIQIYVRKVPDNLDLRRPFKTSTPFSGNQVVEKKNKKNVKSKTASNTKKLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.18
5 0.21
6 0.26
7 0.31
8 0.36
9 0.37
10 0.38
11 0.42
12 0.41
13 0.39
14 0.34
15 0.3
16 0.28
17 0.24
18 0.21
19 0.18
20 0.17
21 0.16
22 0.15
23 0.16
24 0.14
25 0.13
26 0.16
27 0.15
28 0.16
29 0.17
30 0.15
31 0.14
32 0.13
33 0.13
34 0.1
35 0.11
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.1
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.08
49 0.11
50 0.09
51 0.11
52 0.11
53 0.12
54 0.12
55 0.12
56 0.12
57 0.09
58 0.09
59 0.07
60 0.06
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.07
67 0.08
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.07
74 0.07
75 0.06
76 0.1
77 0.11
78 0.12
79 0.11
80 0.1
81 0.14
82 0.14
83 0.17
84 0.18
85 0.18
86 0.18
87 0.2
88 0.2
89 0.2
90 0.24
91 0.25
92 0.25
93 0.25
94 0.25
95 0.24
96 0.26
97 0.32
98 0.34
99 0.34
100 0.38
101 0.44
102 0.46
103 0.48
104 0.48
105 0.42
106 0.41
107 0.46
108 0.42
109 0.42
110 0.48
111 0.46
112 0.48
113 0.54
114 0.49
115 0.46
116 0.47
117 0.45
118 0.46
119 0.53
120 0.56
121 0.58
122 0.66
123 0.67
124 0.71
125 0.76
126 0.78
127 0.77
128 0.79
129 0.8
130 0.83
131 0.83